(data stored in SCRATCH zone)

EMBL: AL009126.SRFAC

AL009126.SRFAC       Location/Qualifiers
FT   CDS_pept        398532..402359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAC"
FT                   /locus_tag="BSU_03510"
FT                   /old_locus_tag="BSU03510"
FT                   /product="surfactin synthetase"
FT                   /function="16.5: Explore"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15066026, 16166527, 16553878,
FT                   17227471, 14762003, 22720735, 26284661; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03510"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12145"
FT                   /db_xref="GOA:Q08787"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="PDB:1JMK"
FT                   /db_xref="PDB:2VSQ"
FT                   /db_xref="SubtiList:BG10170"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08787"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15066026, 16166527, 16553878, 17227471, 14762003,
FT                   22720735, 26284661"
FT                   /protein_id="CAB12145.2"
FT                   /translation="MSQFSKDQVQDMYYLSPMQEGMLFHAILNPGQSFYLEQITMKVKG
FT                   SLNIKCLEESMNVIMDRYDVFRTVFIHEKVKRPVQVVLKKRQFHIEEIDLTHLTGSEQT
FT                   AKINEYKEQDKIRGFDLTRDIPMRAAIFKKAEESFEWVWSYHHIILDGWCFGIVVQDLF
FT                   KVYNALREQKPYSLPPVKPYKDYIKWLEKQDKQASLRYWREYLEGFEGQTTFAEQRKKQ
FT                   KDGYEPKELLFSLSEAETKAFTELAKSQHTTLSTALQAVWSVLISRYQQSGDLAFGTVV
FT                   SGRPAEIKGVEHMVGLFINVVPRRVKLSEGITFNGLLKRLQEQSLQSEPHQYVPLYDIQ
FT                   SQADQPKLIDHIIVFENYPLQDAKNEESSENGFDMVDVHVFEKSNYDLNLMASPGDEML
FT                   IKLAYNENVFDEAFILRLKSQLLTAIQQLIQNPDQPVSTINLVDDREREFLLTGLNPPA
FT                   QAHETKPLTYWFKEAVNANPDAPALTYSGQTLSYRELDEEANRIARRLQKHGAGKGSVV
FT                   ALYTKRSLELVIGILGVLKAGAAYLPVDPKLPEDRISYMLADSAAACLLTHQEMKEQAA
FT                   ELPYTGTTLFIDDQTRFEEQASDPATAIDPNDPAYIMYTSGTTGKPKGNITTHANIQGL
FT                   VKHVDYMAFSDQDTFLSVSNYAFDAFTFDFYASMLNAARLIIADEHTLLDTERLTDLIL
FT                   QENVNVMFATTALFNLLTDAGEDWMKGLRCILFGGERASVPHVRKALRIMGPGKLINCY
FT                   GPTEGTVFATAHVVHDLPDSISSLPIGKPISNASVYILNEQSQLQPFGAVGELCISGMG
FT                   VSKGYVNRADLTKEKFIENPFKPGETLYRTGDLARWLPDGTIEYAGRIDDQVKIRGHRI
FT                   ELEEIEKQLQEYPGVKDAVVVADRHESGDASINAYLVNRTQLSAEDVKAHLKKQLPAYM
FT                   VPQTFTFLDELPLTTNGKVNKRLLPKPDQDQLAEEWIGPRNEMEETIAQIWSEVLGRKQ
FT                   IGIHDDFFALGGHSLKAMTAASRIKKELGIDLPVKLLFEAPTIAGISAYLKNGGSDGLQ
FT                   DVTIMNQDQEQIIFAFPPVLGYGLMYQNLSSRLPSYKLCAFDFIEEEDRLDRYADLIQK
FT                   LQPEGPLTLFGYSAGCSLAFEAAKKLEEQGRIVQRIIMVDSYKKQGVSDLDGRTVESDV
FT                   EALMNVNRDNEALNSEAVKHGLKQKTHAFYSYYVNLISTGQVKADIDLLTSGADFDMPE
FT                   WLASWEEATTGVYRVKRGFGTHAEMLQGETLDRNAEILLEFLNTQTVTVS"
     atgagtcaat ttagcaagga tcaggttcaa gatatgtatt acctatcgcc gatgcaggaa        60
     gggatgcttt ttcatgccat cctgaatccc ggccaaagct tttaccttga acaaatcacg       120
     atgaaagtaa aaggcagctt gaatatcaaa tgtcttgaag aaagcatgaa tgtgatcatg       180
     gaccggtacg atgtatttcg taccgtgttc attcacgaaa aagtaaaaag gcctgtccaa       240
     gtcgtattga aaaaacggca gttccatata gaagaaatcg atctgacaca cttaacgggc       300
     agcgagcaaa cagccaaaat caatgagtac aaagaacagg ataagatcag gggttttgat       360
     ttgacgcggg atattccgat gcgggcagcc attttcaaga aagctgaaga aagctttgaa       420
     tgggtgtgga gctaccacca cattattttg gacggatggt gcttcggcat cgtcgtacag       480
     gatctattta aggtatacaa tgctctgcgc gaacaaaagc cgtacagcct gccgcccgtc       540
     aaaccgtata aagactacat caagtggctt gaaaagcagg ataaacaagc atcactgcgt       600
     tactggcgcg aatatttaga gggctttgaa ggacaaacga cgtttgcgga gcaaagaaag       660
     aaacaaaagg acggctatga gccgaaagag ctgctctttt cactgtcgga ggcggaaaca       720
     aaggccttta ccgagcttgc aaaatcgcag cataccactt tgagtacggc gctgcaggca       780
     gtctggagcg tattgatcag ccgctatcag cagtctggcg atttggcctt cggtacagtt       840
     gtttcagggc gtcccgcgga aatcaaaggc gttgaacata tggtcgggct gtttatcaac       900
     gttgtcccga gacgtgtgaa gctgtctgag ggtatcacat ttaacggctt gctcaagcgg       960
     ctgcaggagc aatcgctgca gtccgagccg catcaatatg tgccgcttta tgacatccaa      1020
     agccaggccg atcagccgaa actgattgac cacatcattg tttttgagaa ctatccgctt      1080
     caggatgcga aaaatgaaga aagcagtgaa aacggctttg atatggtgga tgttcatgtt      1140
     tttgagaagt cgaattatga tctcaacctg atggcttccc cgggagatga gatgctgatt      1200
     aagcttgcct ataatgagaa tgtgtttgat gaggcgttta tcctgcgctt gaaatctcag      1260
     cttcttacag caattcagca gctcatccag aatcctgatc agcctgtcag cacgatcaac      1320
     ctcgttgacg acagggagag agaatttttg ctaaccggct taaacccgcc ggctcaagct      1380
     catgaaacaa agcctctgac gtattggttc aaggaagcag tgaacgccaa tccggatgca      1440
     ccggcgctta cgtattccgg ccagaccctg tcttatcgcg aattagatga ggaagcgaac      1500
     cgcattgcac gccggctgca aaaacacggt gcgggcaaag gctctgttgt agcgctgtac      1560
     acgaagcgct cacttgaact ggtgatcggc attctcggtg tattaaaggc gggagcagcc      1620
     tatctgccgg ttgatccgaa gctgccagag gaccgaatct cgtatatgct ggctgacagt      1680
     gcggcagcct gtcttctgac gcatcaggag atgaaagaac aagcggctga gctgccgtat      1740
     acaggcacaa cgctcttcat tgatgatcaa acacggtttg aagaacaggc aagcgatcct      1800
     gcaaccgcga ttgatcctaa tgatccggca tatatcatgt acacgtccgg cacaaccgga      1860
     aagccaaagg gcaatatcac cactcatgcc aatattcaag gattggtcaa gcatgtagac      1920
     tacatggcat tttctgatca ggatacgttc ttgtctgttt cgaattacgc ctttgatgca      1980
     tttacctttg atttctatgc ttctatgctg aatgcggcac ggctcattat cgcagatgaa      2040
     catacgctgc ttgatacaga acggctcaca gatctgatcc tgcaagagaa tgtcaatgtc      2100
     atgtttgcga caaccgcact atttaatctt ctcacagatg cgggagagga ttggatgaag      2160
     gggcttcgct gtatattatt cggcggagag cgcgcgtcag tgcctcatgt cagaaaagcg      2220
     ctgcggatca tggggccggg caagctgatt aactgctacg ggccgactga gggaacagtg      2280
     tttgcgacag ctcacgtcgt gcatgatctg ccggattcca tctcctcatt gccgatcgga      2340
     aagccgatca gcaatgccag tgtttatatt ctgaatgagc aaagccagct ccagccattc      2400
     ggggcggtcg gtgaactgtg catcagcgga atgggcgtgt caaaagggta tgtaaatcgt      2460
     gctgacctca cgaaggaaaa gtttatcgag aacccgttca agccgggaga aacgctttac      2520
     cgtacagggg atttagcgcg ctggctgccg gatggaacga ttgaatacgc cggccgtatt      2580
     gacgaccagg tcaaaatacg cggacaccgg attgagcttg aagaaatcga aaagcagctg      2640
     caggaatacc caggtgtgaa agatgcggtc gttgtggcgg accgccatga gtctggcgat      2700
     gcatcaatca atgcctacct tgtgaaccga acgcagcttt cagctgaaga cgtgaaggcg      2760
     cacctgaaaa aacagcttcc tgcttacatg gtgccgcaaa cctttacctt cttggatgag      2820
     cttcctttaa cgacgaacgg gaaagtcaat aaacggctgc tcccaaaacc tgatcaggat      2880
     cagctggcgg aagaatggat tggaccgcgg aacgagatgg aagaaacaat cgcacaaata      2940
     tggtctgagg ttctcggcag aaagcaaatt ggcattcatg acgatttctt tgcgctcgga      3000
     gggcattcct tgaaggccat gaccgccgcg tcccgcatca agaaagagct cgggattgat      3060
     cttccagtga agcttttgtt tgaagcgccg acgatcgccg gcatttcagc gtatttgaaa      3120
     aacgggggct ctgatggctt gcaggatgta acgataatga atcaggatca ggagcagatc      3180
     attttcgcat ttccgccggt tctgggctat ggccttatgt accaaaatct gtccagccgc      3240
     ttgccgtcat acaagctatg cgcctttgat tttattgagg aggaagaccg gcttgaccgc      3300
     tatgcggatt tgatccagaa gctgcagccg gaagggcctt taacattgtt tggatattca      3360
     gcgggatgca gcctggcgtt tgaagctgcg aaaaagcttg aggaacaagg ccgtattgtt      3420
     cagcggatca tcatggtgga ttcctataaa aaacaaggtg tcagtgatct ggacggacgc      3480
     acggttgaaa gtgatgtcga agcgttgatg aatgtcaatc gggacaatga agcgctcaac      3540
     agcgaagccg tcaaacacgg cctcaagcaa aaaacacatg ccttttactc atactacgtc      3600
     aacctgatca gcacaggcca ggtgaaagca gatattgatc tgttgacttc cggcgctgat      3660
     tttgacatgc cggaatggct tgcatcatgg gaagaagcta caacaggtgt ttaccgtgtg      3720
     aaaagaggct tcggaacaca cgcagaaatg ctgcagggcg aaacgctaga taggaatgcg      3780
     gagattttgc tcgaatttct taatacacaa accgtaacgg tttcataa                   3828
//

If you have problems or comments...

PBIL Back to PBIL home page