(data stored in SCRATCH zone)

EMBL: AL009126.SRFAD

AL009126.SRFAD       Location/Qualifiers
FT   CDS_pept        402388..403116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srfAD"
FT                   /locus_tag="BSU_03520"
FT                   /old_locus_tag="BSU03520"
FT                   /product="surfactin synthetase"
FT                   /function="16.5: Explore"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16166527, 16553878, 17227471,
FT                   14762003, 22720735, 26284661; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12146"
FT                   /db_xref="GOA:Q08788"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:2K2Q"
FT                   /db_xref="PDB:2RON"
FT                   /db_xref="SubtiList:BG10171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q08788"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16166527, 16553878, 17227471, 14762003, 22720735,
FT                   26284661"
FT                   /protein_id="CAB12146.1"
FT                   /translation="MSQLFKSFDASEKTQLICFPFAGGYSASFRPLHAFLQGECEMLAA
FT                   EPPGHGTNQTSAIEDLEELTDLYKQELNLRPDRPFVLFGHSMGGMITFRLAQKLEREGI
FT                   FPQAVIISAIQPPHIQRKKVSHLPDDQFLDHIIQLGGMPAELVENKEVMSFFLPSFRSD
FT                   YRALEQFELYDLAQIQSPVHVFNGLDDKKCIRDAEGWKKWAKDITFHQFDGGHMFLLSQ
FT                   TEEVAERIFAILNQHPIIQP"
     atgagccaac tcttcaaatc atttgatgcg tcggaaaaaa cacagctcat ctgttttccg        60
     tttgccggcg gctattcggc gtcgtttcgc cctctccatg cttttttgca gggggagtgc       120
     gagatgctcg ctgccgagcc gccgggacac ggcacgaatc aaacgtcagc cattgaggat       180
     ctcgaagagc tgacggattt gtacaagcaa gaactgaacc ttcgccctga tcggccgttt       240
     gtgctgttcg gacacagtat gggcggaatg atcaccttca ggctggcgca aaagcttgag       300
     cgtgaaggca tctttccgca ggcggttatc atttctgcaa tccagccgcc tcatattcag       360
     cggaagaaag tgtcccacct gcctgatgat cagtttctcg atcatattat ccaattaggc       420
     ggaatgcccg cagagcttgt tgaaaataag gaggtcatgt cctttttcct gccttctttc       480
     cgatcagatt accgggctct tgaacaattt gagctttacg atctggccca gatccagtcg       540
     cctgttcatg tctttaacgg gcttgatgat aaaaaatgca tacgagatgc ggaagggtgg       600
     aagaagtggg caaaagacat cacattccat caatttgacg gcgggcacat gttcctgctg       660
     tcacaaacgg aagaagtcgc agaacggatt tttgcgatct tgaatcagca tccgatcatt       720
     caaccgtga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page