(data stored in SCRATCH zone)

EMBL: AL009126.SSPF

AL009126.SSPF        Location/Qualifiers
FT   CDS_pept        53183..53368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="BSU_00450"
FT                   /old_locus_tag="BSU00450"
FT                   /product="small acid-soluble spore protein (alpha/beta-type
FT                   SASP)"
FT                   /function="16.5: Explore"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7959056, 8982008, 11092849;
FT                   Product type cp: cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00450"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11821"
FT                   /db_xref="GOA:P37549"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="SubtiList:BG10108"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37549"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7959056, 8982008, 11092849"
FT                   /protein_id="CAB11821.1"
FT                   /translation="MGRRRGVMSDEFKYELAKDLGFYDTVKNGGWGEIRARDAGNMVKR
FT                   AIEIAEQQMAQNQNNR"
     ttgggcagac gtcgtggagt tatgtcagat gagtttaaat atgagctggc taaagacctt        60
     ggtttttatg acacagtaaa aaatggaggc tggggtgaaa ttcgggcccg cgatgccggt       120
     aacatggtga agcgtgctat tgaaatcgcc gaacagcaaa tggctcagaa tcagaataac       180
     cgataa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page