(data stored in ACNUC7421 zone)

EMBL: AL009126.TADA

AL009126.TADA        Location/Qualifiers
FT   CDS_pept        25852..26337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="BSU_00180"
FT                   /old_locus_tag="BSU00180"
FT                   /product="tRNA specific adenosine A34 deaminase"
FT                   /function="10.3: tRNA and rRNA base modification"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="3.5.4.33"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15677468, 16014871, 16415880,
FT                   16700551, 23658230; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11794"
FT                   /db_xref="GOA:P21335"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="SubtiList:BG10082"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21335"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11794.1"
FT                   /translation="MTQDELYMKEAIKEAKKAEEKGEVPIGAVLVINGEIIARAHNLRE
FT                   TEQRSIAHAEMLVIDEACKALGTWRLEGATLYVTLEPCPMCAGAVVLSRVEKVVFGAFD
FT                   PKGGCSGTLMNLLQEERFNHQAEVVSGVLEEECGGMLSAFFRELRKKKKAARKNLSE"
     atgacacaag atgaacttta tatgaaagaa gcaattaaag aagcgaaaaa ggctgaagag        60
     aaaggtgaag tgccaatagg tgcggtgctt gtcattaatg gtgaaattat agcgcgtgcg       120
     cataatttaa gagagactga acagcgatct attgcccatg cagaaatgct tgtaattgat       180
     gaagcgtgta aggcactcgg aacatggcgg ctggaaggtg cgactcttta tgtgacgctt       240
     gagccttgtc caatgtgtgc tggtgcagtc gtactttctc gagtggaaaa agtggttttt       300
     ggcgcatttg atccgaaagg cggctgttca ggcacgctaa tgaaccttct tcaggaggaa       360
     cgctttaatc atcaggctga agtggtgagc ggtgtgcttg aggaagaatg cggcggaatg       420
     ctcagtgcgt ttttcagaga actaagaaaa aagaagaaag ccgccaggaa aaacttgtct       480
     gaatag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page