(data stored in ACNUC7421 zone)

EMBL: AL009126.TATAD

AL009126.TATAD       Location/Qualifiers
FT   CDS_pept        285775..285987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatAD"
FT                   /locus_tag="BSU_02630"
FT                   /old_locus_tag="BSU02630"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12867413, 15554971, 16678787,
FT                   19049517, 21479530, 27984091; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02630"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12057"
FT                   /db_xref="GOA:O31467"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="PDB:2L16"
FT                   /db_xref="SubtiList:BG12777"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31467"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12867413, 15554971, 16678787, 19049517, 21479530,
FT                   27984091"
FT                   /protein_id="CAB12057.2"
FT                   /translation="MFSNIGIPGLILIFVIALIIFGPSKLPEIGRAAGRTLLEFKSATK
FT                   SLVSGDEKEEKSAELTAVKQDKNAG"
     atgttttcaa acattggaat accgggcttg attctcatct tcgtcatcgc cctcattatt        60
     tttggccctt ccaagctgcc ggaaatcggg cgtgccgccg gacggacact gctggaattt       120
     aaaagcgcca caaaatcact tgtgtctggt gatgaaaaag aagagaaatc agctgagctg       180
     acagcggtaa agcaggacaa aaacgcgggc tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page