(data stored in ACNUC7421 zone)

EMBL: AL009126.TATCD

AL009126.TATCD       Location/Qualifiers
FT   CDS_pept        286048..286776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatCD"
FT                   /locus_tag="BSU_02640"
FT                   /old_locus_tag="BSU02640"
FT                   /product="component of the twin-arginine pre-protein
FT                   translocation pathway"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16698798, 19049517, 27984091;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02640"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12058"
FT                   /db_xref="GOA:P42252"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="SubtiList:BG11175"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42252"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16698798, 19049517, 27984091"
FT                   /protein_id="CAB12058.2"
FT                   /translation="MDKKETHLIGHLEELRRRIIVTLAAFFLFLITAFLFVQDIYDWLI
FT                   RDLDGKLAVLGPSEILWVYMMLSGICAIAASIPVAAYQLWRFVAPALTKTERKVTLMYI
FT                   PGLFALFLAGISFGYFVLFPIVLSFLTHLSSGHFETMFTADRYFRFMVNLSLPFGFLFE
FT                   MPLVVMFLTRLGILNPYRLAKARKLSYFLLIVVSILITPPDFISDFLVMIPLLVLFEVS
FT                   VTLSAFVYKKRMREETAAAA"
     atggataaaa aagaaaccca tctgatcggg catttagaag agcttcgccg ccggattatc        60
     gtcacccttg cggcattttt tctatttctc atcacggctt ttttgttcgt acaggacatt       120
     tatgactggc tgatcaggga tttggatgga aagctggctg tgctaggacc gagtgaaatc       180
     ctctgggtgt atatgatgct ttccggcatt tgtgccattg cggcttctat ccctgttgcc       240
     gcgtaccagc tgtggcgttt cgttgcaccg gcgctgacta aaacggagcg caaggtgacg       300
     ctcatgtaca taccaggttt atttgcgttg tttttggcgg gcatctcctt cggatacttt       360
     gtcttgtttc cgatcgtgct cagctttttg actcatttat cctccggcca ctttgaaacg       420
     atgtttacgg ctgaccgcta ctttaggttt atggtgaatt tgagcctgcc gttcggcttc       480
     ttgtttgaga tgcccttggt ggtgatgttt ttaacaaggc tgggcatctt aaatccttac       540
     agactggcca aagcgagaaa gctttcctat tttctgctga ttgtcgtgtc catattgatt       600
     acaccgcctg attttatttc tgattttctc gtgatgatcc cgcttcttgt cctgtttgaa       660
     gtgagtgtca ccctatcggc gtttgtctac aaaaagagga tgagggaaga aacagcggcg       720
     gccgcttag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page