(data stored in ACNUC7421 zone)

EMBL: AL009126.TCYA

AL009126.TCYA        Location/Qualifiers
FT   CDS_pept        complement(410656..411462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyA"
FT                   /locus_tag="BSU_03610"
FT                   /old_locus_tag="BSU03610"
FT                   /product="cystine ABC transporter (substrate-binding
FT                   lipoprotein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15262924, 22212096; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03610"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12155"
FT                   /db_xref="GOA:P42199"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="SubtiList:BG11187"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42199"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15262924, 22212096"
FT                   /protein_id="CAB12155.2"
FT                   /translation="MKKALLALFMVVSIAALAACGAGNDNQSKDNAKDGDLWASIKKKG
FT                   VLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSK
FT                   RFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNY
FT                   NKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGE
FT                   PQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK"
     atgaaaaaag cattattggc tttattcatg gtcgtaagta ttgcagctct tgcagcttgc        60
     ggagcaggaa atgacaatca gtcaaaagat aatgccaaag atggcgatct ttgggcttca       120
     attaagaaaa aaggtgtgct cacagtcgga acggaaggaa catatgagcc gttcacttac       180
     cacgacaaag acactgataa actgactggc tatgatgtcg aagttatcac agaagtcgca       240
     aaacgcctcg ggcttaaagt cgactttaag gaaacacaat gggacagtat gtttgccggc       300
     ctgaattcca aacggtttga cgttgttgcc aaccaagtcg gaaaaacaga tcgtgaagac       360
     aaatatgatt tctcagataa atacacaaca tcaagagccg ttgtcgtaac gaaaaaagac       420
     aacaacgata ttaagtctga agcagatgta aaaggaaaaa cgtcagctca atcactgaca       480
     agcaactaca acaaattagc tacaaatgcc ggcgctaaag tagaaggcgt tgaaggcatg       540
     gcgcaggccc ttcaaatgat ccagcaaggc cgcgtcgata tgacatacaa cgataagctt       600
     gccgtattga actacttaaa aacatctggc aataaaaacg tgaaaatcgc gtttgaaaca       660
     ggtgagcctc agtcaacata tttcacgttc cgtaaaggaa gcggcgaggt tgttgatcaa       720
     gtcaacaaag cattaaaaga aatgaaagag gacgggactc tttctaaaat ttctaaaaaa       780
     tggttcggcg aagatgtttc taaataa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page