(data stored in ACNUC7421 zone)

EMBL: AL009126.TCYC

AL009126.TCYC        Location/Qualifiers
FT   CDS_pept        complement(409208..409951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcyC"
FT                   /locus_tag="BSU_03590"
FT                   /old_locus_tag="BSU03590"
FT                   /product="cystine ABC transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15262924, 16513748, 22212096;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03590"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12153"
FT                   /db_xref="GOA:P39456"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="SubtiList:BG11185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39456"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15262924, 16513748, 22212096"
FT                   /protein_id="CAB12153.2"
FT                   /translation="MLTVKGLNKSFGENEILKKIDMKIEKGKVIAILGPSGSGKTTLLR
FT                   CLNALEIPNRGELAFDDFSIDFSKKVKQADILKLRRKSGMVFQAYHLFPHRTALENVME
FT                   GPVQVQKRNKEEVRKEAIQLLDKVGLKDKMDLYPFQLSGGQQQRVGIARALAIQPELML
FT                   FDEPTSALDPELVGEVLKVIKDLANEGWTMVVVTHEIKFAQEVADEVIFIDGGVIVEQG
FT                   PPEQIFSAPKEERTQRFLNRILNPL"
     atgcttaccg ttaaaggatt aaacaaatca ttcggtgaaa atgaaatttt aaaaaagata        60
     gatatgaaga ttgaaaaagg aaaagtcatc gccatacttg ggccttcagg ttcagggaaa       120
     acgacgctgc tccgctgcct gaacgctctg gagatcccga atcgcggaga gcttgcattt       180
     gatgatttct ccatcgattt ctccaaaaag gtgaaacagg cggatatcct aaagcttcgc       240
     cgaaaatccg gaatggtgtt tcaggcgtat cacctgttcc cgcaccgcac agccctcgaa       300
     aacgtgatgg agggccctgt tcaggtgcaa aaacggaaca aagaggaagt cagaaaagaa       360
     gcgattcagc ttcttgataa agtcggattg aaggacaaaa tggatttata tccgttccag       420
     ctttccggcg gccagcagca gcgcgtcggc atcgcccgcg cactggcgat acagcctgag       480
     ctcatgctgt ttgacgaacc gacctcagcg cttgatcccg agcttgtcgg agaggtgctg       540
     aaggttatca aggacttggc caatgaaggc tggaccatgg tcgtcgtgac ccacgaaatc       600
     aagttcgcgc aggaggttgc ggatgaagtc atcttcatcg acggcggcgt tatcgtggag       660
     cagggaccgc cggagcaaat tttctccgca ccaaaagaag aacggacaca gcggttctta       720
     aaccggattt tgaacccgct gtaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page