(data stored in SCRATCH zone)

EMBL: AL009126.THRD

AL009126.THRD        Location/Qualifiers
FT   CDS_pept        complement(430623..431987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrD"
FT                   /locus_tag="BSU_03790"
FT                   /old_locus_tag="BSU03790"
FT                   /product="aspartate kinase III"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.2.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2152900, 11471740, 27260660;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03790"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12187"
FT                   /db_xref="GOA:P94417"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="SubtiList:BG12033"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94417"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2152900, 11471740, 27260660"
FT                   /protein_id="CAB12187.1"
FT                   /translation="MKVVKFGGSSLASGAQLDKVFHIVTSDPARKAVVVSAPGKHYAED
FT                   TKVTDLLIACAEQYLATGSAPELAEAVVERYALIANELQLGQSIIEKIRDDLFTLLEGD
FT                   KSNPEQYLDAVKASGEDNNAKLIAAYFRYKGVKAEYVNPKDAGLFVTNEPGNAQVLPES
FT                   YQNLYRLRERDGLIIFPGFFGFSKDGDVITFSRSGSDITGSILANGLQADLYENFTDVD
FT                   AVYSVNPSFVENPKEISELTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPS
FT                   AEGTRVVSKRDNTNGPVVGIASDTGFCSIYISKYLMNREIGFGRRALQILEEHGLTYEH
FT                   VPSGIDDMTIILRQGQMDAATERSVIKRIEEDLHADEVIVEHHLALIMVVGEAMRHNVG
FT                   TTARAAKALSEAQVNIEMINQGSSEVSMMFGVKEAEERKAVQALYQEFFAGVLIS"
     atgaaggtcg ttaaattcgg aggcagctca cttgcttcag gcgcccagct tgacaaggtg        60
     tttcacatcg ttacctcaga tccggcacgg aaagctgtag tcgtttcagc tccgggaaaa       120
     cactatgccg aggatacgaa agtgactgat ctcttaatcg catgtgcaga acaatatttg       180
     gcaacaggca gcgcacctga actggcggaa gctgttgtgg aacggtacgc tctcatcgcc       240
     aatgagcttc agctggggca aagcattatc gaaaaaatca gagatgatct gtttacgctt       300
     ttagaaggag acaaaagcaa tcccgaacaa taccttgacg cagtcaaggc cagcggagag       360
     gataacaatg ccaaactgat cgccgcttac ttccgttata aaggcgtcaa agcggaatat       420
     gtaaacccga aggatgccgg cctctttgtg acaaatgaac ccggcaacgc gcaagttctt       480
     cctgaatcct atcaaaacct ctatcgtctt cgggaacgtg acggactcat catttttccc       540
     ggttttttcg gattcagcaa ggatggcgat gtgatcacat tctcacggag cggttctgat       600
     attaccggtt cgattcttgc caacggacta caagccgatt tgtacgaaaa ctttacagac       660
     gtagacgctg tgtattctgt caatccgtcc ttcgttgaga atccaaagga aatcagcgag       720
     ctgacatata gagagatgcg ggagctgtcc tacgcgggtt tttcagtgtt tcatgatgaa       780
     gcgctcattc cggcattcag agcggggatt cctgttcaga tcaaaaatac gaacaacccc       840
     tcagccgaag gcacccgcgt cgtcagcaag cgggataaca caaacgggcc tgtcgtcggc       900
     attgccagcg acaccggttt ttgcagcatt tatatcagca agtatctcat gaacagagaa       960
     atcggttttg gccgcagagc ccttcaaatc ctggaggagc atggtttgac gtatgagcat      1020
     gttccatcgg gaatcgatga catgacaatc attttacggc aggggcaaat ggatgccgcc      1080
     actgaacgca gcgtcatcaa acggatcgaa gaggatttgc atgccgatga agtcatcgtc      1140
     gagcatcatc tcgccctgat tatggttgta ggggaagcga tgcgccacaa tgtcggtaca      1200
     acggcaagag ccgccaaagc attatcagag gcacaggtga atatcgaaat gatcaatcag      1260
     gggtcttctg aagtgagcat gatgtttggc gtaaaagaag ccgaagaaag aaaagccgtt      1320
     caagcgttat accaggaatt tttcgcgggc gtgctgatct cttaa                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page