(data stored in ACNUC7421 zone)

EMBL: AL009126.TILS

AL009126.TILS        Location/Qualifiers
FT   CDS_pept        74929..76347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="BSU_00670"
FT                   /old_locus_tag="BSU00670"
FT                   /product="tRNA(ile2) lysidine synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.3.4.19"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14527414, 16039592,
FT                   17005971, 22720735, 24001521; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00670"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11843"
FT                   /db_xref="GOA:P37563"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="SubtiList:BG10130"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37563"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14527414, 16039592, 17005971, 22720735,
FT                   24001521"
FT                   /protein_id="CAB11843.1"
FT                   /translation="MKSVKDFLNKHNLTLKGATIIVGVSGGPDSMALLHALHTLCGRSA
FT                   NVIAAHVDHRFRGAESEEDMRFVQAYCKAEQLVCETAQINVTAYAQEKGLNKQAAARDC
FT                   RYQFFEEIMSKHQADYLALAHHGDDQVETMLMKLAKGTLGTGLAGMQPVRRFGTGRIIR
FT                   PFLTITKEEILHYCHENGLSYRTDESNAKDDYTRNRFRKTVLPFLKQESPDVHKRFQKV
FT                   SEALTEDEQFLQSLTKDEMNKVITSQSNTSVEINSSQLLALPMPLQRRGVQLILNYLYE
FT                   NVPSSFSAHHIQQFLDWAENGGPSGVLDFPKGLKVVKSYQTCLFTFEQWQCKNVPFEYQ
FT                   ISGAADETAVLPNGYLIEARHYADSPEEHGNAVFITSEKKVRFPLTIRTRKAGDRIKLK
FT                   GMNGSKKVKDIFIDKKLPLQERDNWPIVTDASGEIIWIPGLKKSIFEDLVIPNSDRIVL
FT                   QYRQHEKCRGQAKS"
     gtgaaaagtg tcaaagattt tttaaacaaa cacaatctta cgttaaaagg ggcgacaatc        60
     attgtaggcg tttccggcgg tccggactca atggctcttc ttcacgcgtt gcatacgtta       120
     tgcggccgtt cagcgaatgt tattgcagct cacgttgacc atcggttcag aggtgcggaa       180
     tccgaggagg acatgcgttt tgtccaagct tattgtaaag ctgaacagct cgtgtgcgaa       240
     acggctcaaa tcaatgtaac cgcatatgca caggaaaaag gactcaataa gcaggctgca       300
     gcacgcgatt gccgctacca gttttttgag gaaatcatgt cgaagcacca agcggactat       360
     ctggctcttg cgcatcatgg tgatgaccag gttgaaacaa tgcttatgaa actggctaag       420
     ggtacgcttg gaacgggact tgcgggaatg cagccggtta gacgttttgg gacagggcgg       480
     atcatcaggc cgttcttaac cattacaaag gaagagatcc ttcactattg ccatgaaaac       540
     ggcttgagct accggacgga tgaaagcaac gccaaagatg actacacaag aaacagattc       600
     agaaaaacag tgctcccgtt tttgaagcag gaatctccgg atgtgcataa aaggtttcag       660
     aaagtgagtg aagcactgac ggaagatgag caattcttac agtcattaac gaaagatgaa       720
     atgaataaag taatcacaag ccagtctaat acatcagttg aaatcaattc ctctcaattg       780
     cttgccctcc cgatgccttt acaaagaaga ggagttcaac taatattaaa ctatctttat       840
     gaaaacgttc catcatcctt ttcagcccat cacattcagc agtttctcga ttgggcggaa       900
     aatggcggtc cttcaggagt actggacttt ccgaaagggc tgaaggtggt caaatcatat       960
     cagacatgtt tgtttacatt tgaacaatgg cagtgcaaaa atgttccctt tgaataccaa      1020
     attagcggag ctgctgatga aacggcagtg ctccctaatg gatatctgat agaggcaagg      1080
     cattatgcgg actcgcctga agaacatggg aatgctgttt ttatcacaag tgaaaaaaag      1140
     gtgcgatttc ccttaacaat ccggacgaga aaagctggag accggatcaa actaaaaggg      1200
     atgaacggct caaaaaaggt aaaggatata tttattgata agaaattgcc tctccaagaa      1260
     agagacaact ggccgattgt gacggacgca agcggtgaaa ttatctggat acctggcttg      1320
     aaaaaatcaa tttttgaaga tcttgtgatt ccaaacagcg accgcattgt attacaatat      1380
     agacagcatg aaaagtgtag ggggcaagca aaatcatga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page