(data stored in SCRATCH zone)

EMBL: AL009126.TLPC

AL009126.TLPC        Location/Qualifiers
FT   CDS_pept        complement(372771..374492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpC"
FT                   /locus_tag="BSU_03440"
FT                   /old_locus_tag="BSU03440"
FT                   /product="methyl-accepting chemotaxis protein (plant
FT                   colonization)"
FT                   /function="16.3: Control"
FT                   /function="16.12: Sense"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7704255, 7921238, 15187186,
FT                   27899502; Product type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12138"
FT                   /db_xref="GOA:P39209"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="SubtiList:BG10790"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39209"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7704255, 7921238, 15187186, 27899502"
FT                   /protein_id="CAB12138.2"
FT                   /translation="MLIKRFKMKLGTKILCLVFVVILLFSASVGTVMLKEITESMKQMA
FT                   TEKAKGDLALSSTYIDDVMSGDWQVKNNKLYKGQTQINGNEDIVDLLGEKTGDTITIFQ
FT                   GDTRVATNVMKNGERAVGTQASSEVIAAVLKKGKRFYGQADVAGSSYQTAYMPLKDQNG
FT                   NIIGMLYTGANQSILASLTQSLFTQFAIVLVIVIMVSVILVLVFTRKINKRLNALKSAF
FT                   ESAGNGDMTIEVSDKTGDELSELSVYYNKMRMKLNDTIQTVQQSALQLASASQQLSAGA
FT                   EETNQASEKITEAVQQIANGAQDQITRIENSESSLKQASADIRDISANTAAIADKGQLA
FT                   QSKADIGQKEIANVQAQMDAIHQSIQKSGEIIHQLDGRSKQIEQILSVITQIADQTNLL
FT                   ALNAAIEAARAGEQGKGFAVVADEVRKLAEESQQSAGQISKLIIEIQKDMNRSARSVEH
FT                   VKTEAAEGVTMIQRTRDAFKEIAAATGEISAEISDLSASVTNISASAHQINDSFAANTA
FT                   DIKESTKNTRQAAALTEEQFAAMEEITAASETLSQLAEELTGIISQFKMINQAENG"
     atgttgataa aacgatttaa gatgaagcta ggaactaaaa ttctttgcct cgttttcgtg        60
     gtgattcttt tgttttcggc atcagttggc actgtgatgc ttaaggaaat tacagaaagc       120
     atgaaacaaa tggcaactga aaaagcgaaa ggtgatctcg ctttaagcag cacttatatt       180
     gatgatgtca tgtcaggcga ctggcaggtg aaaaacaata agctctataa agggcaaaca       240
     caaatcaatg gaaatgaaga tattgttgat ctgcttggtg aaaagacagg tgataccatt       300
     accattttcc aaggcgatac tcgtgttgca accaatgtca tgaaaaatgg cgaaagagcc       360
     gtcggcaccc aggcttcttc tgaagttatt gccgctgttt taaagaaagg aaagcgtttt       420
     tacggacaag cagatgtagc aggttcttct tatcagactg catacatgcc gttaaaagat       480
     caaaatggga acatcatcgg catgctgtat accggagcta atcaaagtat tttagcatca       540
     cttacacaat cacttttcac tcaattcgct atcgttcttg ttatcgtcat tatggtatca       600
     gtcatccttg tcttggtttt caccagaaaa atcaacaagc ggctgaacgc tttaaaaagc       660
     gcctttgaaa gtgccggaaa cggagatatg acaatagagg tgtcagacaa aaccggtgac       720
     gagctttcag aactaagcgt ctattataat aagatgagaa tgaagctgaa cgataccata       780
     caaaccgtac aacaatcagc ccttcagctt gcgtcagcct ctcagcagct ctcagccgga       840
     gcagaggaaa caaatcaagc ttcagaaaaa atcacagaag ctgtacagca gattgcaaat       900
     ggagcccaag atcagatcac ccgaattgaa aatagtgaaa gctcattaaa acaagcttca       960
     gcagacatcc gggatatttc tgcaaatact gccgctatcg ctgacaaagg gcagctcgct      1020
     caatcaaaag cagacattgg acaaaaggaa attgcaaatg tacaggcgca aatggatgcg      1080
     attcaccagt caattcagaa aagcggagaa atcatacacc agttagacgg ccgctctaaa      1140
     caaattgagc aaattttatc ggtcatcacc caaattgctg atcagacaaa cctgcttgcg      1200
     ctgaatgcag cgattgaagc tgccagagcc ggtgaacaag gaaaaggctt tgctgttgtt      1260
     gctgatgaag tacggaaatt agcagaagag tctcaacagt ctgcggggca gatttcaaaa      1320
     ctgatcatag aaatacaaaa ggatatgaac cggtctgcaa gatctgttga gcatgtgaaa      1380
     acagaagctg cagaaggagt caccatgatc cagcgcacca gagatgcatt taaggaaatt      1440
     gcagctgcaa caggtgaaat cagcgccgag attagtgatt tatcagcatc tgtaacaaac      1500
     atttcagcca gtgcacatca aataaatgat tcctttgcag ccaatacggc cgacattaaa      1560
     gaatctacta aaaatacccg gcaagcggct gcattaacag aggagcaatt tgctgcaatg      1620
     gaggagatta ccgcagcttc tgaaacactt tctcaattag ctgaggagct taccggtatc      1680
     ataagccaat ttaaaatgat taatcaagcc gaaaacggct ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page