(data stored in ACNUC7421 zone)

EMBL: AL009126.TMRB

AL009126.TMRB        Location/Qualifiers
FT   CDS_pept        complement(339156..339749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmrB"
FT                   /locus_tag="BSU_03140"
FT                   /old_locus_tag="BSU03140"
FT                   /product="ATP-binding tunicamycin resistance protein"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1624425, 7766032, 15131133,
FT                   27315722; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03140"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12108"
FT                   /db_xref="GOA:P12921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG10456"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12921"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1624425, 7766032, 15131133, 27315722"
FT                   /protein_id="CAB12108.2"
FT                   /translation="MIIWINGAFGSGKTQTAFELHRRLNPSYVYDPEKMGFALRSMVPQ
FT                   EIAKDDFQSYPLWRAFNYSLLASLTDTYRGILIVPMTIVHPEYFNEIIGRLRQEGRIVH
FT                   HFTLMASKETLLKRLRTRAEGKNSWAAKQIDRCVEGLSSPIFEDHIQTDNLSIQDVAEN
FT                   IAARAELPLDPDTRGSLRRFADRLMVKLNHIRIK"
     atgatcattt ggataaacgg ggcattcggt tcgggaaaaa cacaaacagc cttcgaactg        60
     cacagaaggc tgaacccatc ttacgtgtat gatcccgaga aaatgggttt tgcgctgcgc       120
     tccatggtgc cgcaggagat cgcaaaggac gattttcaaa gctatccttt atggcgggcg       180
     ttcaattaca gtttgctagc ttctctgaca gatacatacc gcggcatcct tattgtgcct       240
     atgacgattg tacaccctga atacttcaat gagatcatcg gcaggctcag acaggaaggc       300
     aggatcgttc accactttac actaatggct tcaaaggaaa ccttgttaaa aaggctgcgc       360
     accagagcag aaggaaaaaa ctcatgggcc gccaaacaaa ttgaccgctg tgttgaagga       420
     ttatcatcac ccatttttga ggaccacatt caaacagaca acctgtcgat tcaggatgtg       480
     gcagagaaca ttgccgcgag agccgaactc ccattagatc ctgatacaag aggcagcctc       540
     cgaaggttcg ccgacagatt aatggtaaag ctgaatcata tccgcatcaa ataa             594
//

If you have problems or comments...

PBIL Back to PBIL home page