(data stored in ACNUC7421 zone)

EMBL: AL009126.TRMNF

AL009126.TRMNF       Location/Qualifiers
FT   CDS_pept        42917..43660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmNF"
FT                   /locus_tag="BSU_00340"
FT                   /old_locus_tag="BSU00340"
FT                   /product="tRNA1(Val) (adenine(37)-N6)-methyltransferase"
FT                   /function="16.3: Control"
FT                   /function="10.3: tRNA and rRNA base modification"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.1.1.223"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 22905870, 24809820; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11810"
FT                   /db_xref="GOA:P37543"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="SubtiList:BG10098"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37543"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11810.1"
FT                   /translation="MVSLHDDERLDYLLAEDMKIIQSPTVFAFSLDAVLLSKFAYVPIQ
FT                   KGKIVDLCTGNGIVPLLLSTRSKADILGVEIQERLHDMAVRSVEYNKLDDQIQIIHDDL
FT                   KNMPEKLGHNRYDVVTCNPPYFKTPKQTEQNMNEHLRIARHEIHCTLEDVISVSSKLLK
FT                   QGGKAALVHRPGRLLEIFELMKAYQIEPKRVQFVYPKQGKEANTILVEGIKGGRPDLKI
FT                   LPPLFVYDEQNEYTKEIRTILYGDK"
     atggtttcat tacatgatga tgaaagatta gattatttgc tggcagagga catgaaaatc        60
     atacaaagcc caacagtgtt tgctttttcg ttggacgctg tgcttctgtc caaatttgcg       120
     tacgttccga ttcaaaaagg gaaaattgtt gatttatgca ccggcaatgg tattgtgccg       180
     ctgctgctca gtacaagatc aaaagcagac attctgggag tcgaaattca agaaagactg       240
     catgatatgg ctgttcgcag cgtggagtat aataagttgg acgatcagat ccagatcata       300
     catgatgacc tgaaaaacat gccggagaaa cttggacata atcgatatga tgttgtcacc       360
     tgcaatccgc cgtattttaa aacgccgaaa caaactgaac aaaacatgaa cgagcatctc       420
     cgaatcgcaa gacatgaaat ccactgcacg ctggaggatg tcatttcagt cagcagcaag       480
     ctgctcaagc aagggggaaa agcagctctt gttcaccggc cgggaaggct tctggagatt       540
     tttgaactga tgaaggctta tcaaatcgag ccgaaacgtg tacaatttgt ctatccgaag       600
     caagggaaag aagccaatac cattttggtt gaaggtatca aaggcgggcg cccggatttg       660
     aaaattcttc ctcccttatt cgtatatgat gaacaaaatg aatatacaaa agaaatcagg       720
     accattttat atggagacaa ataa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page