(data stored in ACNUC7421 zone)

EMBL: AL009126.TRUA

AL009126.TRUA        Location/Qualifiers
FT   CDS_pept        152937..153680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BSU_01480"
FT                   /old_locus_tag="BSU01480"
FT                   /product="tRNA pseudouridine (38-40) synthase"
FT                   /function="16.6: Maintain"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="5.4.99.12"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10529181, 15353568, 17114947,
FT                   17466622; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01480"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11924"
FT                   /db_xref="GOA:P70973"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="SubtiList:BG11992"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70973"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11924.2"
FT                   /translation="MRLKCTISYDGHLFNGYQVQPGKRTVQDELEKALAVLHKSKDRIP
FT                   VVSSGRTDSGVHAAGQVIHFDTPLSIPAERWPYALNALLPDDIAVKQAEIADDGFHARF
FT                   SAVKKEYRYFVYTEKHPDVFKRHYAYHFSYRLNVQDMREAAKHLIGTHDFTSFCAAKTE
FT                   VQDKVRTIYELDWTETADGLQMRITGSGFLYNMVRIIAGTLLDAGIGKISPDEVKSMLE
FT                   AKDREAAGRTAPGHGLYLWNVYYDN"
     atgagactga aatgcacgat ttcttatgac ggacatttgt ttaacggtta tcaggttcag        60
     ccgggcaaaa gaacggttca ggatgaactg gagaaggctt tggctgtcct gcataagtca       120
     aaagacagaa ttccggtcgt ttcgtctgga agaacagaca gcggggttca cgcagccgga       180
     caggtgattc attttgacac tccgctgtct atcccggctg agagatggcc atatgcctta       240
     aatgcactgc ttccggacga tatcgcagtc aaacaggcag aaattgcgga tgatgggttc       300
     catgcacgat ttagcgcagt caaaaaagaa tatcgctact ttgtatacac ggagaaacac       360
     ccggacgtat ttaaacggca ttacgcttac catttttcat atcgccttaa tgtgcaggac       420
     atgagagaag cggcaaagca tcttataggg acacatgatt ttacgagctt ttgcgcggct       480
     aaaacagaag tgcaggacaa ggtaagaacg atatacgaac ttgattggac tgagacggct       540
     gacggcctgc aaatgcggat cacaggcagc ggtttcttat ataatatggt cagaattatt       600
     gcgggtactt tgcttgatgc aggtattgga aaaatttctc ccgatgaggt gaaatccatg       660
     ctggaagcga aggatcgcga agcggcaggg cgcacagcgc cggggcacgg gctatattta       720
     tggaacgttt actatgacaa ctaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page