(data stored in SCRATCH zone)

EMBL: AL009126.UBIX

AL009126.UBIX        Location/Qualifiers
FT   CDS_pept        412540..413154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="BSU_03630"
FT                   /old_locus_tag="BSU03630"
FT                   /product="phenolic acid decarboxylase-flavin
FT                   prenyltransferase subunit"
FT                   /function="3.2: Degradation"
FT                   /EC_number="4.1.1.61"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 10919793, 15979273,
FT                   17295427, 18388975, 26083743, 26658822, 26337367; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03630"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12157"
FT                   /db_xref="GOA:P94404"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR032901"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="SubtiList:BG12023"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94404"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12157.1"
FT                   /translation="MKAEFKRKGGGKVKLVVGMTGATGAIFGVRLLQWLKAAGVETHLV
FT                   VSPWANVTIKHETGYTLQEVEQLATYTYSHKDQAAAISSGSFDTDGMIVAPCSMKSLAS
FT                   IRTGMADNLLTRAADVMLKERKKLVLLTRETPLNQIHLENMLALTKMGTIILPPMPAFY
FT                   NRPRSLEEMVDHIVFRTLDQFGIRLPEAKRWNGIEKQKGGA"
     atgaaagcag aattcaagcg taaaggaggg ggcaaagtga aactcgttgt cggaatgaca        60
     ggggcaacag gggccatttt cggggtcagg ctgctgcagt ggctgaaggc cgccggagtg       120
     gaaacccatc tcgttgtgtc tccttgggca aacgtcacga tcaaacacga aacaggctat       180
     acgttacaag aagtagaaca actggccaca tacacttact cacataagga tcaggcggca       240
     gccatttcaa gcgggtcgtt tgataccgat ggaatgattg ttgcgccgtg cagcatgaaa       300
     tctctcgcaa gcattcgcac aggaatggcg gataatctgc tgacacgtgc ggcggatgtc       360
     atgctcaagg agagaaaaaa actcgtcctc ttaacgagag agacgccttt gaaccaaatt       420
     catctcgaaa atatgctagc gcttacgaaa atgggcacca tcattcttcc tccgatgccg       480
     gcattttata atcggccgag aagcttagag gaaatggttg accatattgt ttttagaacg       540
     ttggaccaat tcggcattcg gcttcctgaa gcgaagcgct ggaatgggat tgaaaaacaa       600
     aaaggaggag cttga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page