(data stored in ACNUC7421 zone)

EMBL: AL009126.XPAC

AL009126.XPAC        Location/Qualifiers
FT   CDS_pept        35845..36459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpaC"
FT                   /locus_tag="BSU_00250"
FT                   /old_locus_tag="BSU00250"
FT                   /product="putative phosphatase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 23155385; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11801"
FT                   /db_xref="GOA:P37467"
FT                   /db_xref="InterPro:IPR018770"
FT                   /db_xref="SubtiList:BG10089"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37467"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11801.1"
FT                   /translation="MQRFFHFLVWSLTSSATFVFIGILSFFGLNQSIFLSIVYGLASGA
FT                   AVYIAGIWNARRLFLKKHELTGREYAYIKKNLEEARQKMVRLRKALFQAKSIQMFKQNA
FT                   EMLRIVRRIYLLTKKEPKRFYQAERFFYQTLDSVVELTEKYAFLSSHPKKSKELSMSLS
FT                   ETRITLTELTKRLEEDLTQAMGDEIDELQFELDAAKHSLKK"
     atgcagagat tttttcactt tttggtgtgg agtttaacta gcagtgcgac ttttgttttc        60
     attggaatat tgagcttttt tggtttaaac cagtcgattt ttttatctat tgtttatggg       120
     cttgcttctg gagcagccgt atatatagct ggcatctgga atgcaagacg gttatttctt       180
     aaaaagcatg aattgacagg aagagagtat gcttacatta agaaaaactt agaggaagca       240
     aggcagaaaa tggtccgtct taggaaagcc ttgtttcagg ctaaaagcat tcaaatgttt       300
     aagcaaaatg cagaaatgct aaggattgtg agaaggattt atctcctcac caaaaaagag       360
     ccaaagcggt tttatcaggc agaacgattt ttttatcaaa ctctcgattc ggttgttgaa       420
     ttgacagaga agtatgcttt tctatcatct cacccaaaaa aaagcaaaga actgtcgatg       480
     tcgttaagtg agacacgcat cactcttact gaattgacca agcgtttaga ggaagattta       540
     actcaagcaa tgggtgatga aattgacgag ttgcagtttg aattagacgc agcaaaacat       600
     tcattaaaga aataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page