(data stored in SCRATCH zone)

EMBL: AL009126.YAAC

AL009126.YAAC        Location/Qualifiers
FT   CDS_pept        complement(14847..15794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaC"
FT                   /locus_tag="BSU_00080"
FT                   /old_locus_tag="BSU00080"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 22333191"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00080"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11784"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="SubtiList:BG10072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37526"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11784.1"
FT                   /translation="MTYHEWKDLALFYSVESTQKFLEKVYILNGINDAKKNSFKNSERF
FT                   IYFLKHAESFYKQAAYSPLEIKPILLFYGMAQLIKACLITRDPHYPSHTSVLAHGVTTR
FT                   KRKKQNYCFSDDEVKIQRNGLCVHFMKHLFGQSDIVDERYTMKKLLMAIPELSDIFYFQ
FT                   QKERFMTKVEKDKNEIFVPEEVVINYKMSDSRFAEYMSHHYQWSFTKKNEHGLLFEISP
FT                   QDKEPWTSTSLLFDMEKNQYYIPSQREQFLRLPEMTIHYLILYNVGMIARYETEWWYEL
FT                   LTQHISDDYVLIQQFLLVSEKKFPKYASQFLLHF"
     atgacatatc atgagtggaa agacttagcg ctattttact ccgttgaatc aacccagaaa        60
     tttctagaaa aggtttatat cttaaacggt attaacgatg cgaaaaaaaa ctcttttaaa       120
     aacagtgaac ggtttattta tttcttaaag catgccgaat cgttttataa acaagccgca       180
     tattctccct tagaaatcaa accgattctt ttattttatg gaatggcaca gcttatcaaa       240
     gcatgcttaa ttacacgtga tcctcattat ccaagccata catcagtact ggcacatggc       300
     gtaacaacaa gaaaacgaaa gaaacaaaat tattgtttta gcgacgatga agtgaaaata       360
     caacggaatg gcctatgcgt acattttatg aaacatttat tcggacaatc ggatatagta       420
     gatgaacggt ataccatgaa aaaattatta atggccattc cagaacttag cgatattttc       480
     tactttcagc agaaagaacg atttatgaca aaagttgaga aggataagaa cgaaattttt       540
     gtaccggagg aagtagtaat caattacaaa atgtctgatt caaggtttgc tgaatacatg       600
     tcccatcatt atcaatggtc ttttacaaaa aaaaatgaac acgggctgct gttcgaaatt       660
     tcaccacaag acaaggagcc atggacatcg accagcttat tgtttgacat ggaaaagaac       720
     caatattata tcccttctca aagggagcaa tttctgaggc ttcccgaaat gacaattcat       780
     tatttgattt tgtacaacgt tgggatgatt gcaaggtatg aaacagaatg gtggtatgag       840
     ttattaacac agcatataag tgatgactac gtgttaattc agcagttttt attagtatca       900
     gaaaagaaat tccctaaata cgcttcacag tttcttcttc atttttaa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page