(data stored in SCRATCH zone)

EMBL: AL009126.YAAI

AL009126.YAAI        Location/Qualifiers
FT   CDS_pept        complement(25221..25766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="BSU_00170"
FT                   /old_locus_tag="BSU00170"
FT                   /product="putative amidase (isochorismatase family)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 2521622; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00170"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11793"
FT                   /db_xref="GOA:P37532"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="SubtiList:BG10081"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37532"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11793.1"
FT                   /translation="MSKADKALLIVDMINNFEFDMGETLAKKTEKIVPHILSLKEHARQ
FT                   NEWPIIYINDHYGLWQADIKNIQQECTNERSKDIITKIAPVDADYFLIKPKHSAFYETA
FT                   LHTLLTELQVRHIIITGIAGNICVLFTANDAYMREYSITIPKDCIASNSDEDNEFALTM
FT                   MENVLFAEITTEEQIIEK"
     ttgtccaaag cagataaagc ccttctcatt gtagacatga tcaataattt tgaattcgat        60
     atgggggaaa ccctcgctaa aaaaacagaa aaaatcgttc ctcatatttt atcattaaag       120
     gagcacgcga gacaaaatga atggccgatt atttacatca atgatcatta tggactttgg       180
     caagctgaca ttaaaaacat acagcaagaa tgcacaaatg aaagaagcaa ggatatcatc       240
     acaaagatag ctccggtaga tgctgattat tttttaatca aaccgaaaca ttccgctttc       300
     tacgaaacag cacttcacac ccttcttact gagttgcagg tgagacatat tatcataaca       360
     ggtatagccg gcaatatatg cgtgctgttt accgctaatg acgcttatat gagggaatac       420
     agcatcacga ttcctaagga ctgtatcgcg tcaaacagtg acgaagataa cgaattcgcc       480
     ttaaccatga tggagaatgt tcttttcgca gaaattacga cggaagaaca aattatagaa       540
     aaataa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page