(data stored in SCRATCH zone)

EMBL: AL009126.YAAN

AL009126.YAAN        Location/Qualifiers
FT   CDS_pept        36478..37638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaN"
FT                   /locus_tag="BSU_00260"
FT                   /old_locus_tag="BSU00260"
FT                   /product="putative toxic compound resistance protein"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 12533473, 20713661"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11802"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="SubtiList:BG10090"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37535"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11802.1"
FT                   /translation="MNRDQSDLHIDELLADPFGGNIEIPGSEAVKAEKEQVRLVDVLPE
FT                   ENKEKAIQLAGQIDHKNMQSIVLYGSQAQSKLLNFSHDMINHVQKKDVGEIGEILGELM
FT                   KKLEQVNPDDLQSKKKGFLARMFGRVSSSLQEVLSKYQKTSVQIDRISLKLEHSKNALI
FT                   SDNKLLEQLYEKNKEYFAALNVYIAAGELKLEELKTKTIPELKQQAESSDHNQMAVQEV
FT                   NDLIQFADRLDKRVHDLLLSRQITIQSAPQIRLIQNTNQALAEKIQSSIVTAIPLWKNQ
FT                   VAIALTLLRQRNAVDAQQKVSDTTNELLLKNAELLKTNTIETARANERGLVDIDTLKKV
FT                   QESLISTLEETLTIQEEGRIKRRQAEEELMMMEGDLKQKLITIKER"
     atgaaccgag accaaagcga ccttcatata gatgaattat tggcagatcc ttttggtggt        60
     aacatagaga taccaggttc ggaggctgta aaagcagaga aagagcaagt acggcttgtt       120
     gatgttcttc ctgaggaaaa caaggaaaaa gcaattcagc ttgctggaca gattgatcat       180
     aaaaatatgc aaagcattgt cttatacggt tcacaagctc aatctaaact gctgaacttt       240
     tctcatgata tgattaatca tgttcaaaag aaggatgtcg gggagattgg cgaaatactt       300
     ggagagctga tgaaaaagct ggagcaagta aatcctgatg atctccaatc taagaaaaag       360
     ggttttttgg cacgcatgtt tggaagagta tcaagttctc ttcaagaggt gctgtctaaa       420
     taccaaaaga ccagtgtgca gatagacaga atcagcttga agctggagca ctctaaaaat       480
     gctttaatca gtgacaacaa gctgttagag cagttatatg aaaaaaataa agaatatttc       540
     gcagcgctga atgtttatat tgctgcagga gaactgaagc tggaggaatt aaaaacaaaa       600
     acgattcctg aactgaagca acaggctgaa tcgagtgatc ataaccaaat ggccgttcaa       660
     gaggtgaatg atttaattca atttgctgac cggttagata aaagggtgca tgatttgctg       720
     ctgagcaggc aaattacaat ccaaagtgca ccgcaaatca ggctgattca aaatacaaac       780
     caagcgttag ctgaaaagat tcagtcatcc attgtgacag cgattccgtt atggaaaaat       840
     caagttgcca ttgcactgac gcttttaagg cagcgcaatg cagtggatgc acagcagaaa       900
     gtatctgata caaccaatga gcttttgctg aaaaatgcgg agcttttaaa aaccaataca       960
     attgaaactg cacgggcaaa tgaaagaggc cttgttgata tagatacctt gaagaaggtg      1020
     caggaaagct taataagcac gcttgaagaa acactgacta tacaagaaga aggacgaatc      1080
     aaacgccgtc aggcagaaga agagctcatg atgatggaag gcgacctgaa gcaaaagctg      1140
     attacaataa aggaaagatg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page