(data stored in ACNUC7421 zone)

EMBL: AL009126.YAAO

AL009126.YAAO        Location/Qualifiers
FT   CDS_pept        37720..39162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaO"
FT                   /locus_tag="BSU_00270"
FT                   /old_locus_tag="BSU00270"
FT                   /product="putative decarboxylase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 9723923, 20876533,
FT                   24529384; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11803"
FT                   /db_xref="GOA:P37536"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="SubtiList:BG10091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37536"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11803.1"
FT                   /translation="MNTPLYKALIQHARRNSHSFHVPGHHNGDVFFDDAKSIFDPLLTI
FT                   DVTELAGLDDLHHPSGVIKEAQELASQLYGSAESFFLVNGTTVGNLAMILSVCEPGDTI
FT                   LVQRNCHKSVFHAVDLSGAEPVYLAPDVDSAMHVPTHVPLGTIKEALEAYPDAKGLVLT
FT                   NPTYYGHSADLTEIITEAHHYGIPVLVDEAHGAHFILGEPFPVSALKMGADIVVQSAHK
FT                   TLPAMTMGSYLHLNSSCRINRDRVAEYLNRLQSSSPSYPIMASLDIARAYVQHIIEEQK
FT                   LSDILQRIETLKQTFDSLTNAEAVNPANPLIITDPLKLTIRSKRGHSGYTLQSILERAN
FT                   IFTELADENQVLLVLPLGGKRRINAEIIRSIDEEIEKTPPDQTFVSAEWGVQPVTVLPY
FT                   PKKVLHSFKKEYVSFEEAAGRLNAEDIIPYPPGIPMIMAGERITKESVQKLSRLISMKT
FT                   HVQGNMKIKEKQLLVYIEEEKS"
     atgaacacac ctttatataa agcattaatt caacatgcga gaagaaattc tcattcattt        60
     catgttccgg gacatcacaa tggagatgtc ttttttgatg acgctaagtc aatattcgat       120
     ccgcttctca ccattgatgt aactgaactg gcaggactgg atgatctcca tcatccttct       180
     ggggtgatta aggaagctca ggagcttgcc agtcaattat atggatcggc ggaaagtttt       240
     tttctggtaa atggtacgac tgtcggaaac ttagcgatga ttttatctgt ttgtgaacct       300
     ggtgatacaa ttctggttca aagaaactgt cataaatctg tatttcatgc tgttgatttg       360
     tccggtgctg agccggttta tcttgcacct gacgttgatt cagcgatgca tgtgcctacg       420
     catgttccgc ttggaacaat taaagaggcc ctggaagcat atccagatgc gaaaggcttg       480
     gtactgacca atccgacata ttacggacat agtgctgatt tgactgagat cattactgaa       540
     gcccatcatt acgggattcc tgttttggtc gatgaagcgc atggcgcaca ttttatttta       600
     ggtgagcctt ttccggtctc agctttaaaa atgggggcag atattgttgt tcagtcggcc       660
     cacaaaacgt tgccagccat gacgatgggt tcttatttgc atctcaacag cagctgcagg       720
     attaacaggg atcgggtggc agagtattta aaccgattac aaagcagcag cccgtcttat       780
     ccgattatgg cttcgttaga tattgcccgc gcttatgtac agcatattat agaagaacaa       840
     aagctttctg acattctgca gcggatagaa acacttaaac aaacgtttga ttcacttaca       900
     aatgcagaag ctgttaaccc tgctaatcca ctgatcatca cggatccgct aaagctcaca       960
     attcgttcaa aacgcgggca ttctggctat acgctgcaaa gcattttaga gcgtgccaac      1020
     atattcactg agcttgctga tgaaaatcaa gttctgctcg ttctcccatt gggaggaaaa      1080
     cggagaataa acgctgaaat cattagaagc atcgatgaag agattgagaa aacgcctccg      1140
     gatcagacgt ttgtttctgc agaatggggt gtgcagcctg ttactgtctt gccttatcca      1200
     aaaaaggtct tacattcgtt taagaaagaa tatgtgagct ttgaggaagc agctggccgg      1260
     cttaatgcag aagatatcat cccttatcct ccgggtatcc cgatgattat ggcgggagaa      1320
     agaataacaa aagaaagtgt gcaaaagctc agccgcttga tcagcatgaa aacgcatgtt      1380
     caagggaata tgaaaatcaa agagaaacaa ctacttgttt atatagaaga ggagaaatca      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page