(data stored in ACNUC7421 zone)

EMBL: AL009126.YAAR

AL009126.YAAR        Location/Qualifiers
FT   CDS_pept        40213..40653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaR"
FT                   /locus_tag="BSU_00300"
FT                   /old_locus_tag="BSU00300"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 22333191, 22720735"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11806"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="SubtiList:BG10094"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37539"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11806.1"
FT                   /translation="MKINKDIRTFIDNKQIPSVKTSEITASFKTSMENQSSKMKLDQLT
FT                   RLLSDIEAFGKRLTKSRNFKDLARFKGLVKRFVKEAVDSGLSHETSKSFDLYGNSRTLG
FT                   LVKEIDDKLIQLTEEMMDQEKPAIDLLERIGEIKGLLINLYT"
     gtgaaaatta ataaagatat acgtacattt atagataata agcagattcc ctctgtgaaa        60
     acatctgaga tcacagcatc gtttaaaaca tcaatggaaa accaaagcag caaaatgaag       120
     cttgatcagc ttaccaggct gttatctgat atagaagcat ttggaaaaag gctaacgaaa       180
     tctcggaatt ttaaagactt agcgagattt aaaggacttg tgaaacgttt tgtcaaagaa       240
     gctgtggaca gcggtctttc acatgaaaca tcgaaaagct ttgaccttta cgggaacagc       300
     agaacgctgg gacttgtgaa agaaatagat gacaaattga tacagcttac ggaagagatg       360
     atggatcagg aaaaaccggc aattgatttg ctggagcgta ttggcgaaat aaaaggttta       420
     ttaattaacc tttacacata g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page