(data stored in ACNUC7421 zone)

EMBL: AL009126.YABE

AL009126.YABE        Location/Qualifiers
FT   CDS_pept        48629..49942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabE"
FT                   /locus_tag="BSU_00400"
FT                   /old_locus_tag="BSU00400"
FT                   /product="putative cell wall shaping enzyme"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15774001, 19047346;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11816"
FT                   /db_xref="GOA:P37546"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="SubtiList:BG10103"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37546"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11816.1"
FT                   /translation="MGEREGRVDSLLDTLYNLSEEKEAFFITQKMKKLFSVKLSKSKVI
FT                   LVAACLLLAGSGTAYAAHELTKQSVSVSINGKKKHIRTHANTVGDLLETLDIKTRDEDK
FT                   ITPAKQTKITADMDVVYEAAKPVKLTINGEEKTLWSTAKTVGALLDEQDVDVKEQDQID
FT                   PAIDTDISKDMKINIEPAFQVTVNDAGKQKKIWTTSTTVADFLKQQKMNIKDEDKIKPA
FT                   LDAKLTKGKADITITRIEKVTDVVEEKIAFDVKKQEDASLEKGKEKVVQKGKEGKLKKH
FT                   FEVVKENGKEVSRELVKEETAEQSKDKVIAVGTKQSSPKFETVSASGDSKTVVSRSNES
FT                   TGKVMTVSSTAYTASCSGCSGHTATGVNLKNNPNAKVIAVDPNVIPLGSKVHVEGYGYA
FT                   IAADTGSAIKGNKIDVFFPEKSSAYRWGNKTVKIKILN"
     ttgggagaaa gagaagggag ggttgacagc cttttagata ctctatataa tctctccgag        60
     gagaaggagg cgtttttcat cacacaaaaa atgaaaaagc tgttttccgt aaagcttagc       120
     aaaagcaaag tcattctggt tgctgcttgt ttgcttttgg caggaagcgg gactgcgtac       180
     gcggctcatg agctgacgaa acaatcagtc tcagtttcta tcaatggcaa aaagaaacat       240
     atacgcacac atgcaaatac agtcggtgat cttttggaga cgcttgatat aaagacaaga       300
     gacgaagaca agatcacacc tgctaaacag acaaagataa cagcagacat ggacgttgtg       360
     tatgaggctg caaaacctgt gaagcttaca ataaacgggg aagaaaagac gttatggtca       420
     acagcaaaaa cggtcggtgc attactggac gaacaagatg ttgatgtgaa agaacaagat       480
     caaattgatc ccgcaataga tacagatatt tcgaaagaca tgaagattaa catagagccc       540
     gcatttcagg ttactgtgaa tgatgcaggg aaacaaaaga agatctggac gacttcgact       600
     acggtcgctg actttttaaa acagcaaaag atgaacataa aagacgaaga taaaatcaag       660
     cctgcgttag atgcaaagct gacgaaagga aaggctgata ttacaattac tcgtatcgaa       720
     aaggtcaccg atgtagttga agagaagatt gcgttcgatg tgaaaaagca agaagacgct       780
     tctcttgaaa aagggaaaga aaaggtcgtc caaaaaggaa aagaaggcaa gctaaaaaaa       840
     catttcgaag tcgttaaaga aaacggtaaa gaagtgtcca gagagcttgt aaaagaagaa       900
     acagctgaac aaagcaaaga taaagtgatt gctgtcggca caaagcaaag cagtccaaaa       960
     tttgaaacgg tcagtgcttc aggtgattca aaaacagttg tgtcccgcag caatgaatca      1020
     acaggcaaag tcatgactgt atcatctacg gcttatacgg caagctgcag cggttgttca      1080
     ggacatacag cgacaggcgt caatttaaaa aataatccga atgccaaagt catcgctgtg      1140
     gatccaaatg tcattccgct aggctccaaa gtccacgtgg aaggctatgg atatgccatt      1200
     gctgcagata ccggttcagc gattaaaggg aacaagatag acgtcttttt cccagagaaa      1260
     tcatcggcgt accgatgggg aaataaaaca gtcaaaatta aaatcttaaa ttag            1314
//

If you have problems or comments...

PBIL Back to PBIL home page