(data stored in SCRATCH zone)

EMBL: AL009126.YABN

AL009126.YABN        Location/Qualifiers
FT   CDS_pept        66405..67874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="BSU_00580"
FT                   /old_locus_tag="BSU00580"
FT                   /product="putative fusion methylase and nucleotide
FT                   pyrophosphohydrolase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 11178267; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00580"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11834"
FT                   /db_xref="GOA:P37556"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="SubtiList:BG10121"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37556"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11834.1"
FT                   /translation="MAGKITVVGLGAGDMDQLTIGIHKLLTKADTLYVRTKDHPLIEEL
FT                   EKETKNIRFFDDIYEKHDQFEAVYEEIADILFEAARREDVVYAVPGHPFVAEKTVQLLT
FT                   ERQEKENVQVKVAGGQSFLDATFNVLQIDPIEGFQFVDAGTLSADELELRHHLIICQVY
FT                   DQMTASEVKLTLMEKLPDDYEVVIVTAAGSRGEEIRTVPLFELDRNVALNNLTSVYIPP
FT                   IKEEKLLYHEFSTFRSIIRELRGPNGCPWDKKQTHQSLKQYMIEECYELLEAIDEEDTD
FT                   HMIEELGDVLLQVLLHAQIGEDEGYFTIDDVIKGISEKMVRRHPHVFKDVKVQDENDVL
FT                   ANWEDIKKAEKNTSESSLLDSVPKTLPALSKAAKLQKKAAKVGFDWEDVSDIWEKVSEE
FT                   MKEFSSEVSEAPHEHNLKAEFGDILFALVNVARFYKIEPEEALTMTNDKFRRRFSYIEE
FT                   TAKEEGVELADMSLEDMDKLWNEAKETERRS"
     atggcgggta aaattacagt cgtcggactt ggtgccggag acatggacca attgacaatt        60
     ggtatacaca agctgctgac gaaggcagat acgctgtatg tcagaaccaa ggatcatcct       120
     ttaattgagg agcttgaaaa agaaacgaag aacatccgtt tctttgatga tatatatgag       180
     aaacatgatc agttcgaggc ggtatatgaa gaaattgcag atatcctctt tgaagcggcg       240
     cggcgtgagg acgtggttta cgctgtgccg ggacaccctt ttgtcgcaga aaaaacagtt       300
     cagctgctga cggagcggca ggaaaaggaa aacgttcaag tgaaagtcgc ggggggacaa       360
     agtttccttg atgccacatt caatgtcttg caaattgacc cgattgaagg ttttcaattt       420
     gtggatgccg gcacattgtc cgcggatgag cttgagctca gacatcatct gatcatatgt       480
     caggtttacg accaaatgac ggcttctgaa gtcaagctga cattgatgga gaagctgcct       540
     gatgattatg aggtcgtcat tgtgactgca gcaggcagcc gtggcgagga gatcaggaca       600
     gtgccattat ttgagctgga ccgcaatgtc gctttgaaca acttaacaag tgtgtatatt       660
     ccgccgatta aagaagagaa gctgctttat cacgaattct ccacgttccg aagcatcatc       720
     agagagcttc gcggacctaa tggatgtccg tgggataaaa agcagacgca tcagtcatta       780
     aagcagtaca tgattgaaga atgttatgag cttctcgaag ctattgacga agaagacaca       840
     gaccatatga tcgaagagct tggcgacgtt ttgcttcagg tcttgcttca cgcgcaaatt       900
     ggtgaagatg aaggttattt cacaattgat gatgtcataa aaggaatcag tgaaaaaatg       960
     gtccgaagac atccccatgt gtttaaagat gttaaggttc aggatgaaaa cgatgtttta      1020
     gccaattggg aagatataaa aaaggccgaa aaaaatacat ctgaatcatc attactagac      1080
     agcgtaccga aaacccttcc agctctttcg aaagcagcta aattgcagaa aaaagcagcg      1140
     aaggtcggtt ttgactggga agacgtcagc gatatttggg aaaaggtaag tgaggaaatg      1200
     aaggaatttt cttctgaggt ttctgaagct cctcacgaac acaatcttaa agctgagttt      1260
     ggcgacattt tgttcgcgct ggtgaatgta gcccgcttct acaaaataga gccagaggaa      1320
     gcgctgacca tgactaatga caaattccgg agacggttct cgtacattga ggaaacagcg      1380
     aaggaagagg gagtcgagtt ggctgatatg tcccttgagg acatggacaa actgtggaat      1440
     gaagcaaaag aaactgagag gagatcatag                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page