(data stored in ACNUC7421 zone)

EMBL: AL009126.YABR

AL009126.YABR        Location/Qualifiers
FT   CDS_pept        69626..70012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabR"
FT                   /locus_tag="BSU_00630"
FT                   /old_locus_tag="BSU00630"
FT                   /product="putative RNA degradation protein;
FT                   polyribonucleotide nucleotidyltransferase or phosphorylase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 9862121, 15066026,
FT                   16014871, 22720735; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00630"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11839"
FT                   /db_xref="GOA:P37560"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="SubtiList:BG10126"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37560"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11839.1"
FT                   /translation="MSIEVGSKLQGKITGITNFGAFVELPGGSTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAKDRPQARPRNDFRPKESFEQKMNKFLKD
FT                   SEDRLSSLKRNTESKRGGRGARRG"
     atgtcgattg aagttggcag caagttgcaa gggaaaatta caggtattac aaattttgga        60
     gcatttgttg aattgcctgg aggctcaacc ggtctcgttc acattagtga ggtagctgat       120
     aattatgtca aagacattaa cgaccactta aaagtcggcg accaagttga agtgaaagtc       180
     atcaacgttg aaaaagacgg gaaaattggt ttatctatta aaaaagctaa agaccgtccg       240
     caagccagac ctagaaatga tttccgtccg aaagaatctt ttgaacagaa aatgaataag       300
     tttttaaaag acagcgaaga tcgcttgtca tctttaaaac gcaatacgga atcaaaacgt       360
     ggagggcgcg gagcaagaag aggataa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page