(data stored in SCRATCH zone)

EMBL: AL009126.YABS

AL009126.YABS        Location/Qualifiers
FT   CDS_pept        73106..73843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabS"
FT                   /locus_tag="BSU_00650"
FT                   /old_locus_tag="BSU00650"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00650"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11841"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="SubtiList:BG10128"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37561"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11841.1"
FT                   /translation="MNNGHLNQILLITDGCSNHGEDPLAMAAFAKEQGITVNVIGIMEE
FT                   NQIDPEAMKEVEGIALAGGGVHQVVYASQLSQTVQMVTKKAMTQTLQGVVNQELKQILG
FT                   KNVEMEELSPEKRGEVMEVVDELGETVHLQVLVLVDTSASMAPKLPTVKEALIDLSVSL
FT                   NSRIGNNEFAMCIFPGKKQEVELVLNWTPKLQSLSTLFAKLSTGGITPTGPAIREATLQ
FT                   FEKIRSRRGMLADDERRFDEFGM"
     gtgaacaacg gacatttaaa tcaaattttg ctgataacgg atggctgctc aaaccatggg        60
     gaagacccgc ttgcaatggc tgcttttgct aaagagcagg ggattacggt aaatgtcatt       120
     ggtataatgg aagaaaatca aattgaccct gaggcaatga aggaagtcga agggattgca       180
     cttgccggag gaggcgtgca ccaagtcgtt tatgcatctc agctttcaca aactgttcaa       240
     atggtaacaa agaaagcgat gacgcaaacc ttacaaggtg tagtcaatca agaactgaaa       300
     cagattctcg gaaagaatgt ggaaatggaa gagctttctc cggaaaaacg cggcgaagtc       360
     atggaagtgg tagacgagct tggagaaacg gtgcatcttc aggttttggt tcttgttgat       420
     acaagtgcaa gtatggcgcc aaagcttcca acagtaaaag aggcgctgat tgatttgtct       480
     gtaagcctca attcccgaat tgggaataac gaatttgcga tgtgtatatt tcccgggaaa       540
     aaacaagagg tcgagcttgt gctgaactgg acaccgaagc tgcaatctct ttccacactc       600
     tttgcaaagc tttcgacagg cggcatcacg ccgacaggtc cggcgattcg tgaagcgaca       660
     ctgcagtttg aaaaaatacg ctcaagaagg ggcatgctgg cagatgatga acgacgcttt       720
     gacgagtttg gcatgtag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page