(data stored in SCRATCH zone)

EMBL: AL009126.YACD

AL009126.YACD        Location/Qualifiers
FT   CDS_pept        80802..81695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacD"
FT                   /locus_tag="BSU_00720"
FT                   /old_locus_tag="BSU00720"
FT                   /product="putative protein chaperone accessory lipoprotein
FT                   factor"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15187182, 15856219;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00720"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11848"
FT                   /db_xref="GOA:P37566"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="SubtiList:BG10135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37566"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11848.1"
FT                   /translation="MKSRTIWTIILGALLVCCIAVAYTLTKSQAGASSSGESIATIGGK
FT                   SVTREEWLKEMEDQYGKSTLEDMINVRVVEQLAKKNKLKISKSEVDREFLLIKAVNNSF
FT                   YEDEHTTEKEWKDQIRYNILLEDLLTRDIDISNKELESFYNKNKELYQFDDSYRIRHIV
FT                   VKDEEEAREVLKELKGGSSFEAVAAERSTDRYTSPYGGDLGFVTEASDNIPSAYIEEAK
FT                   TLKEDEWSQEPIKVSNGYAIIQLKEKLKARTFSFDEVKDQIRRQIAMDQLGDKATVKTL
FT                   WKEADVSWFYGEKSTK"
     ttgaaatcaa gaacaatctg gaccattatt ttaggggcgc tgttggtttg ctgtattgct        60
     gttgcatata cgctgacgaa atcccaagcc ggcgcatcgt catccggtga gtctattgcg       120
     actatcggag gcaagagtgt gacaagagaa gaatggctga aagaaatgga agatcagtat       180
     ggtaagtcaa cgcttgaaga tatgatcaat gtccgagttg ttgagcagct ggctaaaaag       240
     aacaaactta aaatatccaa aagcgaagtt gatcgtgagt ttttgctgat taaagcggtc       300
     aataattcct tttacgaaga tgaacatacg acggagaaag agtggaaaga ccaaattcgt       360
     tataatatcc tccttgagga tttgttaaca agggatatcg atatctcaaa caaagaattg       420
     gaatcattct ataataaaaa taaggaacta tatcagtttg atgattcgta tcgaattcgg       480
     cacattgttg taaaagatga agaagaagca agagaagtcc tgaaagaact gaaaggcgga       540
     tcaagctttg aagctgtcgc tgccgaaaga tctacagaca gatatacatc accatacggc       600
     ggagatttag gttttgtcac agaggcatca gacaacattc catcagcata cattgaagag       660
     gcgaaaacac tcaaagagga tgaatggtct caggaaccaa taaaggtcag caacggatat       720
     gccattatcc agctgaaaga aaaactaaag gcaagaacgt tctcatttga tgaagtaaag       780
     gaccagatca gacggcaaat cgcaatggat cagctaggcg ataaagcgac agttaagaca       840
     ctttggaaag aagccgatgt atcttggttt tatggggaaa aaagtactaa gtga             894
//

If you have problems or comments...

PBIL Back to PBIL home page