(data stored in ACNUC7421 zone)

EMBL: AL009126.YACL

AL009126.YACL        Location/Qualifiers
FT   CDS_pept        108674..109774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="BSU_00890"
FT                   /old_locus_tag="BSU00890"
FT                   /product="putative membrane protein possibly involved in
FT                   RNA binding"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 26999498; Product type
FT                   m: membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00890"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11865"
FT                   /db_xref="GOA:Q06754"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="SubtiList:BG10151"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06754"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11865.1"
FT                   /translation="MLKRIVQAFFIIFGGVVGIFLIPELFVLLNIQDIPLITNAYTSAA
FT                   IGAIIFFLISIWGTEYVVNWVKWIEDSLLKAPVPDLLFGSLGLVFGLIIAYLIVNVIPL
FT                   DNIPYRIFSTIIPVFLAFFLGYLGFQVGFKKKDELISLFSISARMQKKKGTADEEHEVQ
FT                   DKKLKILDTSVIIDGRIADICQTGFLEGVIVIPQFVLEELQHIADSSDVLKRNRGRRGL
FT                   DILNRIQKELDIEVEIYEGDFEDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQKVA
FT                   VLNINDLANAVKPVVLPGEEMNVQVIKDGKEHNQGVAYLDDGTMIVVEEGRNYIGKHID
FT                   VLVTSVLQTAAGRMIFAKPKLLEKAL"
     atgttaaaac gaatagttca ggcgttcttc attatttttg gcggcgttgt tggtatattt        60
     ttgatacctg aattgtttgt actgttaaat atacaggaca tacctttaat aacaaacgca       120
     tatacgtctg cggcaatagg agcaattatc ttttttctca tcagtatatg gggtacagaa       180
     tacgttgtga actgggtgaa gtggatagag gattcattgt taaaagcgcc ggttccagat       240
     ttgttatttg gaagtcttgg cttagttttt ggacttataa ttgcttatct tatcgtaaat       300
     gttattcctt tagacaatat accttaccgc atattcagca caataattcc tgtatttttg       360
     gctttcttcc tcggttatct cggcttccag gtgggcttta agaaaaagga tgaattgatc       420
     agcctgtttt ccatttccgc cagaatgcaa aagaaaaaag gaacagctga tgaagaacat       480
     gaggttcaag acaagaagct gaaaattttg gacactagtg ttattattga tgggagaata       540
     gcagatattt gtcagactgg ttttttagag ggagttatcg tgattccgca gtttgtcctt       600
     gaggaattgc agcatattgc agactcttca gatgttttaa aacgaaacag aggacgccgc       660
     ggtcttgata tcctgaaccg cattcagaaa gaattagaca ttgaagttga aatttacgaa       720
     ggcgactttg aagatattca ggaggttgac agcaagctcg tcaaacttgc taagctgaca       780
     tccggggtcg ttgtgacgaa tgattttaat ttaaataaag tgtgcgagct tcagaaggta       840
     gcagtattaa acattaatga ccttgccaat gcggttaagc ctgttgtgct tcctggcgag       900
     gaaatgaatg ttcaggtcat taaggacggg aaagagcata atcagggagt tgcctacttg       960
     gatgacggta cgatgattgt cgttgaagaa ggacggaatt atatcggcaa gcatattgat      1020
     gtactcgtca caagtgtgct gcagacagca gcgggacgaa tgatttttgc gaagcctaag      1080
     ctgttggaga aggcgctgta a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page