(data stored in SCRATCH zone)

EMBL: AL009126.YAZA

AL009126.YAZA        Location/Qualifiers
FT   CDS_pept        43647..43946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazA"
FT                   /locus_tag="BSU_00350"
FT                   /old_locus_tag="BSU00350"
FT                   /product="putative UvrC-Intron-type (URI) endonuclease"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 11483577; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00350"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11811"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="SubtiList:BG12700"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31414"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11811.1"
FT                   /translation="METNNHFFYVVKCKDNSWYAGYTNDLHKRVKTHNDGKGAKYTKVR
FT                   RPVELIFAESFSTKREAMQAEYYFKKLTRKKKELYIEEKRNSKEAVYVKAPNEL"
     atggagacaa ataaccattt cttctacgtc gtgaaatgta aggacaatag ctggtatgcc        60
     gggtatacca acgatctgca taaacgagtg aaaacgcaca atgatggaaa gggcgcaaag       120
     tacacaaaag taagacgtcc ggttgaatta atttttgccg agagcttttc aacaaagcgg       180
     gaagctatgc aggcggaata ttatttcaaa aaactaactc ggaagaaaaa agagctttat       240
     atagaagaaa agcggaacag caaggaggct gtatatgtta aggcgccaaa tgagctttaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page