(data stored in ACNUC7421 zone)

EMBL: AL009126.YBAC

AL009126.YBAC        Location/Qualifiers
FT   CDS_pept        134171..135127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaC"
FT                   /locus_tag="BSU_01140"
FT                   /old_locus_tag="BSU01140"
FT                   /product="putative proline iminopeptidase"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.11.5"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01140"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11890"
FT                   /db_xref="GOA:P70981"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG11988"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70981"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11890.2"
FT                   /translation="MIPEKKSIAIMKELSIGNTKQMLMINGVDVKNPLLLFLHGGPGTP
FT                   QIGYVRHYQKELEQYFTVVHWDQRGSGLSYSKRISHHSMTINHFIKDTIQVTQWLLAHF
FT                   SKSKLYLAGHSWGSILALHVLQQRPDLFYTYYGISQVVNPQDEESTAYQHIREISESKK
FT                   ASILSFLTRFIGAPPWKQDIQHLIYRFCVELTRGGFTHRHRQSLAVLFQMLTGNEYGVR
FT                   NMHSFLNGLRFSKKHLTDELYRFNAFTSVPSIKVPCVFISGKHDLIVPAEISKQYYQEL
FT                   EAPEKRWFQFENSAHTPHIEEPSLFANTLSRHARHHL"
     atgattcctg aaaagaaatc aatcgcaatc atgaaagaac taagcattgg aaatacaaag        60
     caaatgctga tgattaatgg agttgacgtg aaaaatccat tgctgctttt tttacatggc       120
     gggccgggaa cgccgcaaat cggatatgtt agacattatc aaaaagagct ggaacagtat       180
     tttacagtag ttcattggga tcagagagga tcggggcttt cttattctaa gcgaatttcg       240
     catcactcta tgacaataaa tcacttcatt aaagatacaa tccaagtcac tcaatggctt       300
     ttagctcatt tttcaaaatc aaaactttac ctagccggtc attcttgggg atcaatactg       360
     gcgcttcatg tgctgcagca gcgtcctgat ttattttaca cgtattatgg aatcagccag       420
     gttgttaacc cgcaagatga agaatcaact gcttatcaac atattcgtga aatttccgaa       480
     tcaaaaaaag ccagcatatt atctttcctt acacgtttca ttggtgctcc gccttggaag       540
     caggatatcc agcaccttat ctatcggttt tgtgttgagc taaccagggg aggattcact       600
     caccgtcatc gtcaatctct cgctgtatta tttcaaatgc ttactggcaa tgagtatgga       660
     gtgcggaaca tgcacagctt ccttaatgga ttgcgcttca gtaaaaaaca tttaactgat       720
     gagttgtacc ggtttaatgc ttttacatca gttccttcta ttaaagtacc gtgtgttttc       780
     atttcaggga aacatgactt aattgttcct gcagaaatat cgaaacagta ttatcaagaa       840
     cttgaggcac ctgaaaagcg ctggtttcaa tttgagaatt cagctcacac cccgcatatt       900
     gaggagccat cattattcgc gaacacatta agtcggcatg cacgacacca tttatga          957
//

If you have problems or comments...

PBIL Back to PBIL home page