(data stored in ACNUC7421 zone)

EMBL: AL009126.YBAK

AL009126.YBAK        Location/Qualifiers
FT   CDS_pept        156109..156552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="BSU_01520"
FT                   /old_locus_tag="BSU01520"
FT                   /product="conserved protein of unknown function"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 14679227, 16267290"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11928"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="SubtiList:BG11503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50862"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11928.1"
FT                   /translation="MAEVLSFMDVKRQKDFELEKNLLKELSLRQIIQSVKDCLEPLFPF
FT                   LHDERDIITEGCIDFAIEAYLLGGRFGIFGYYGESMQSISARSAREEEELRMEFFDYLY
FT                   NWIHEQYATFDKNTVYEAARKFIKDWWTAGFVQREKQCKLRMR"
     atggcagaag tactgtcttt tatggatgtg aaacgccaaa aggattttga attagaaaag        60
     aacttgctca aagaactctc tctgagacaa attatccagt ctgttaagga ttgtttggaa       120
     ccattatttc catttttaca tgatgaacga gatattatta ccgaaggctg tattgatttt       180
     gcgattgaag cttatttgtt aggcgggcgt tttgggatat tcggctatta cggagaatca       240
     atgcagagta tcagtgcccg ctctgcaaga gaagaagaag agctgcgtat ggagtttttt       300
     gattatctct ataattggat acacgagcaa tacgcaacat ttgataaaaa cactgtttat       360
     gaagcggcac gcaagttcat taaagattgg tggacagcag ggtttgttca aagagaaaaa       420
     cagtgtaagc ttcgcatgcg gtaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page