(data stored in SCRATCH zone)

EMBL: AL009126.YBBC

AL009126.YBBC        Location/Qualifiers
FT   CDS_pept        complement(185194..186438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbC"
FT                   /locus_tag="BSU_01650"
FT                   /old_locus_tag="BSU01650"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01650"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11941"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="SubtiList:BG10833"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40407"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11941.1"
FT                   /translation="MRKTIFAFLTGLMMFGTITAASASPDSKNQTAKKPKVQTGIDTLL
FT                   PDYKKQLKGKRIGLITNPAGVNTSLKSSVDILYENPDIKLTALFGPEHGVRGDAQAGDE
FT                   VGSYIDEKTGVPVYSLYGKTKKPTPEMLKNVDILMFDIQDVGTRFYTYIYTMAYAMEAA
FT                   KENGIPFMVLDRPNPQGGNHIEGPILEPEYASFVGLYPIPLKHGMTIGELASLFNKEFS
FT                   IDADLTVVKMKHWKRKMDFDDTRLPFVLPSPNMPTVESTFVYPATGLIEGTNISEGRGT
FT                   TKPFELIGAPFIKSTELEETLNSLHLPGVTFRAASFTPTFSKHQGTLCHGVQLYVTDRD
FT                   KFEAVKTGLSVIKTIHDLYPEDFEFLSTGSFDKLAGNGWIRTKIENGTSVENIINSYEK
FT                   TLQQFSKTRKKYLIY"
     atgagaaaaa caatattcgc ttttctgaca gggctcatga tgttcggaac gataaccgct        60
     gcctctgctt cacccgattc aaagaatcaa acagctaaaa aacctaaagt ccagactggg       120
     atagacacgc tcttgccaga ctataaaaaa cagctcaagg gaaaacgcat cggactgatc       180
     accaatccag ccggagtaaa cacatctcta aaaagcagtg tcgatatcct ttacgagaac       240
     ccggatatca aactgacagc tttattcggc cctgaacacg gcgtccgcgg tgacgcccag       300
     gctggagacg aagtaggctc ttacattgac gaaaaaaccg gggttcccgt atacagcctc       360
     tacggaaaaa cgaaaaaacc gactccagaa atgcttaaaa atgtcgatat tctaatgttt       420
     gacattcagg atgtcgggac ccgtttctac acgtacattt atacaatggc atacgcaatg       480
     gaagccgcta aagaaaacgg cattccattt atggtgctgg accgtccgaa tcctcaaggc       540
     gggaatcata ttgaaggacc aatcttagaa cctgaatacg cctcatttgt cggattgtat       600
     cccattccat tgaagcatgg gatgacgata ggcgaattgg cttcactgtt caacaaagaa       660
     tttagtattg atgccgatct tacagtggta aaaatgaaac actggaaacg aaaaatggat       720
     tttgacgata cccgattgcc tttcgtcctc ccttcgccta acatgccgac ggtggaaagc       780
     acatttgttt atcctgcaac cgggctgatt gaaggaacaa atatatccga agggcgaggg       840
     acaacaaagc cattcgaatt gatcggagct ccctttatca aaagcacaga acttgaagaa       900
     acattaaaca gcctccattt gccgggcgtt acatttaggg cagcatcctt cacaccgacg       960
     ttttctaaac atcaaggaac gctttgccac ggtgtgcagc tctatgtgac agacagagat      1020
     aagtttgaag ccgttaaaac gggtctttca gtcattaaaa ccatacacga tctctatcct      1080
     gaggattttg agttcctgtc aacaggttca ttcgataaac tggcaggcaa cggctggatc      1140
     aggacaaaaa ttgaaaatgg aacttcggtt gagaacatca taaacagcta tgaaaaaaca      1200
     ctccaacaat tcagcaaaac aagaaaaaag tatctcattt attag                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page