(data stored in ACNUC7421 zone)

EMBL: AL009126.YBBJ

AL009126.YBBJ        Location/Qualifiers
FT   CDS_pept        complement(193075..193557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="BSU_01710"
FT                   /old_locus_tag="BSU01710"
FT                   /product="putative acyltransferase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01710"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11947"
FT                   /db_xref="GOA:Q45583"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="SubtiList:BG11571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45583"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11947.2"
FT                   /translation="MTQDISLSFYKPEHLPELQSFTLTNDDKRFTSLPKEVLSQALGIQ
FT                   DRYPVVILKDDLPVGFFILHASKETLASYSNNPFALLLSSLSLTAVHHGKGYAKKAMLL
FT                   LPAFVSGYFPWCDEIILAVNHLNIRAKHLYMKSGFLDKGRRRIGPLGEQLILHHFL"
     atgactcaag acatttcttt atccttctat aagcctgaac acttgcccga gctccaatca        60
     ttcacgctca ccaacgatga caaacgcttt acctccctcc cgaaagaggt gctgtctcag       120
     gctctgggca tacaggaccg atacccggtt gtcatcttaa aagacgacct tccagtcggt       180
     tttttcattt tacatgcatc aaaagaaacg cttgcttcct attctaacaa tccatttgct       240
     ttactgctca gctccctgtc tttaaccgct gtgcatcacg gaaaaggcta tgcgaaaaaa       300
     gccatgcttt tgcttcccgc ttttgtgagc ggatattttc catggtgcga cgaaatcatc       360
     ttggccgtca atcatctgaa catacgcgca aaacaccttt atatgaaaag cgggttcctt       420
     gataaaggac ggcgaagaat cgggccgctt ggagaacagt tgatccttca tcatttctta       480
     tag                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page