(data stored in SCRATCH zone)

EMBL: AL009126.YBBK

AL009126.YBBK        Location/Qualifiers
FT   CDS_pept        complement(193570..194025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="BSU_01720"
FT                   /old_locus_tag="BSU01720"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01720"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11948"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="SubtiList:BG11572"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45584"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11948.2"
FT                   /translation="MILVSSCLGGIECRYNGSHAASEKIRKLVDEKKAVMACPELLGGF
FT                   STPREPAEIIGGTGEDVLNGTAKIVTASGEDVTELYMEGAAKTLAYAKEINASAVILKE
FT                   NSPSCGSGFIYNGTFSGKKITGSGVTAALLKQAGYRVISENELNDIL"
     atgattctag tcagttcttg ccttggaggc attgaatgca gatataacgg ctctcacgca        60
     gcgtcggaga aaatcagaaa actagtcgat gaaaagaaag cagtcatggc ttgccctgaa       120
     cttctcggcg gcttctctac cccacgcgaa cccgcagaaa tcataggagg cactggcgag       180
     gatgtcctca atggaacagc gaaaatcgtg acagcttcag gagaagacgt cacagaacta       240
     tatatggaag gcgccgcgaa aacattggct tacgcaaaag aaatcaacgc ttctgccgtc       300
     atattaaaag aaaacagtcc atcttgcgga agcggtttta tctataacgg cacattctct       360
     ggcaaaaaaa tcaccggcag cggagtaacc gccgcactgt taaaacaagc gggctaccgc       420
     gtcatttcgg aaaacgagct taacgacata ttgtaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page