(data stored in SCRATCH zone)

EMBL: AL009126.YBBU

AL009126.YBBU        Location/Qualifiers
FT   CDS_pept        202126..202266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbU"
FT                   /locus_tag="BSU_01790"
FT                   /old_locus_tag="BSU01790"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2K4Z9G0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SOX90537.1"
FT                   /translation="MSKSERTSTVEKWIKEVDGTGPDYRSTMAIDLRCFLIRSVNQVKR
FT                   H"
     atgtccaaaa gcgaaagaac gtctacagtg gaaaaatgga ttaaagaagt tgatggtaca        60
     ggacccgact atcgatcgac catggctata gatttaagat gtttcctcat tagatcggtc       120
     aatcaggtta aaaggcatta a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page