(data stored in ACNUC7421 zone)

EMBL: AL009126.YBCC

AL009126.YBCC        Location/Qualifiers
FT   CDS_pept        206941..209556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcC"
FT                   /locus_tag="BSU_01845"
FT                   /old_locus_tag="BSU01845"
FT                   /product="conserved transmembrane protein coupled to
FT                   NADH-ubiquinone oxidoreductase chain 5 homolog; prophage 1
FT                   region"
FT                   /function="18: Unknown function"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01845"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11960"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="SubtiList:BG12706"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34688"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11960.2"
FT                   /translation="MGITSVLTKDNVKKIDTDIDVQERDLNVFITSASRVIAPLWPIST
FT                   FAARNPWMGLENQPFDQVASWLKNTRDVDIYPSASMIRSAKNKGEIDEDFVEMGLQRWL
FT                   DSHSYHIPRDVAERFCHAALKLDPLPSDLLSSHELEKLVSECSGLDHIENVFMQPLSSY
FT                   IENQDGERLVNILDHHVIKWSKLYLDDSQAGWTMPNREEGFYRAWQHLIQYDPALSKKQ
FT                   RERVKGWPKEAHLALQEALFALEIPESEIQTYLEGHLLSLPGWAGMMLWRSQQSSHEHA
FT                   LLTEYLAVRISMEWALIKPYLPLTNERSKKTISIAPLIAAWIHWGGLTLEEWSQMTASE
FT                   QNEYLSFAYSFDEKLRKKLWLEAWEQTYTDRLSQKIISKQRETGREKSALAQLAFCIDV
FT                   RSEPFRRQLEKEGPFETIGIAGFFGVPIATCELGSKHSHASLPIIQKPQNKIKEFADED
FT                   VFKKYNQRKQAIHSLSHTFKTMKQNALSSLLLPELSGPWLTLQMAARSFVPRKAGRFIR
FT                   NLREAWLRKPDTKLSLHHDATEAEIPVGFTDEEKVNYARQALKMMGLTENIAPLVVICG
FT                   HGSQSTNNPYSAALDCGACGGAAGGFNARVLAALCNLSEVREALLAEGIKIPEDTVFAA
FT                   AEHNTTVDELHWLYVPELSEAAQEAFEQIEAVMPKVRHHVNAERLAQLPNFQSKLKNPK
FT                   AEANRFAEDWSEIRPEWGLARNAAFIIGKRELTQDCDLEGRAFLHNYDWKQDESGELLA
FT                   NIIVGPGTVAQWINLQYYASTVAPHYYGSGNKATQTVTAGLGVMQGNASDLLAGLPWQS
FT                   VMESDHEAYHSPLRLLILIQAPREYVERLLNHDSAFLQKVQNGWVRLASLDPEGCWESW
FT                   "
     atgggcatta catccgtatt aacgaaagat aatgtaaaaa agatagatac agatattgat        60
     gttcaagaaa gggatcttaa cgttttcatt acatctgcca gccgagtgat tgcgccactt       120
     tggcctattt ctacatttgc tgcacgtaat ccgtggatgg gacttgaaaa ccaacctttt       180
     gatcaggttg caagttggtt gaaaaacact cgcgatgttg atatataccc tagtgcgtct       240
     atgatccgtt cagcaaagaa taaaggtgag attgatgaag attttgtgga aatggggctg       300
     cagcgttggc ttgattcaca ttcctatcac atcccacggg acgtagcaga gcgattttgt       360
     catgctgcat taaagttaga tcccctgcct tccgaccttt tatcatcaca tgagctggag       420
     aaattagtaa gtgaatgtag tggattggat catatcgaga atgtgtttat gcagccacta       480
     agttcgtata tagagaatca agatggtgaa aggctagtca atatactaga tcatcatgtc       540
     attaaatgga gtaaattata tcttgatgac tctcaagcgg gttggacaat gcctaatcgt       600
     gaggaaggtt tctatcgtgc ttggcagcat cttattcaat atgatccagc acttagcaaa       660
     aagcagcgag aaagggtaaa aggttggccg aaagaggcac atttggcttt acaagaagct       720
     ttattcgcac tagaaatccc agagtcagaa atccagactt atcttgaagg tcatttactt       780
     tcattacctg gatgggcagg gatgatgctt tggcgctccc aacaatcgag ccacgaacat       840
     gcactactaa cagaatattt agcggttcga atatccatgg agtgggctct tataaagcca       900
     tacttacctt tgactaatga acgatctaag aaaacaattt caattgctcc ccttatagca       960
     gcttggattc attggggtgg gcttacatta gaagaatggt cacagatgac ggccagtgaa      1020
     caaaacgaat atttatcatt tgcctacagc tttgatgaga aacttcgcaa gaaactttgg      1080
     ttagaagctt gggaacaaac gtacactgat cgattaagcc agaagatcat ctcgaaacaa      1140
     cgtgaaaccg gccgtgaaaa atctgcatta gctcaattag cattctgcat cgatgtacga      1200
     tcagaacctt ttcgtcgtca actagaaaaa gaaggcccgt ttgaaacgat tggtattgct      1260
     ggtttcttcg gggtgccgat tgcaacttgt gaacttggca gtaaacacag tcatgcttcc      1320
     ttgccgatca tacaaaaacc gcaaaataaa ataaaagagt tcgcagatga ggatgtattc      1380
     aaaaaataca atcaacggaa gcaagcaatt cattctttaa gccatacctt taaaacgatg      1440
     aagcagaatg cgctttcgag cttactactg cctgagctaa gtggaccttg gcttactctg      1500
     caaatggcag cccgtagctt tgtgccaaga aaggcgggtc gtttcattcg taatctccgt      1560
     gaggcttggt tacgcaaacc tgatacaaaa ctctcgcttc atcatgatgc tacagaggca      1620
     gaaatacctg tgggttttac tgatgaagaa aaagtgaact atgctcgcca agcattaaaa      1680
     atgatggggt taacagagaa catcgcacca ttggtcgtga tttgtgggca tggcagtcaa      1740
     agtactaata atccttattc tgcagccctt gattgtggtg cctgtggtgg agcggccggt      1800
     ggattcaatg caagagtttt agctgcttta tgtaatctat cagaggtacg agaagctctt      1860
     ttagctgaag gaattaaaat tcctgaggat acagtttttg cagcagctga acataataca      1920
     acagtagatg aattacattg gctttatgta ccagagcttt ccgaagctgc acaagaagca      1980
     tttgaacaaa ttgaagccgt tatgccgaaa gtgagacatc atgtaaacgc agaacgtcta      2040
     gcccaattac cgaatttcca atcgaagcta aaaaatccga aggctgaggc aaaccgattt      2100
     gcggaagatt ggagtgagat acgtccggaa tggggactgg ctcgtaatgc cgcttttatt      2160
     atcggtaaac gtgaattaac tcaggattgt gatttggaag gcagagcctt tctccataat      2220
     tatgattgga agcaggatga aagcggtgaa ctcctagcaa atattattgt aggacctgga      2280
     actgtagccc aatggattaa tttacaatat tacgcatcaa cggtagcacc tcattattat      2340
     ggcagcggaa ataaagcaac tcaaaccgtt actgcaggtc tcggcgttat gcaggggaat      2400
     gcaagcgatt tgttagccgg actgccttgg caatccgtca tggaatcaga tcacgaggcc      2460
     tatcattctc ctcttcgttt attgatactc atccaagcac ctagagaata tgtagaacgg      2520
     ttattaaatc atgattcagc atttctgcaa aaagttcaaa atggatgggt ccgactggct      2580
     agtcttgatc cagaaggatg ttgggaaagc tggtaa                                2616
//

If you have problems or comments...

PBIL Back to PBIL home page