(data stored in ACNUC7421 zone)

EMBL: AL009126.YBCH

AL009126.YBCH        Location/Qualifiers
FT   CDS_pept        210224..210514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="BSU_01870"
FT                   /old_locus_tag="BSU01870"
FT                   /product="conserved protein of unknown function; prophage 1
FT                   region"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01870"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11963"
FT                   /db_xref="SubtiList:BG12709"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34795"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11963.1"
FT                   /translation="MSANLTDFVTKTIEEMNSFDRENMECIKKLIRKAIDFYHLKSYEE
FT                   VEETHSGNVRFLHVHSMMEENMLSKMIVVTRNGKTDLDIEGVYEGYVVREY"
     atgagcgcta atttaactga ttttgtcacg aaaacaatag aggaaatgaa ctcgtttgat        60
     cgtgaaaata tggaatgtat aaaaaaacta attagaaaag caattgattt ttatcatcta       120
     aagtcttatg aagaagttga ggaaacccat tcaggaaatg ttcgattttt gcatgtccac       180
     tctatgatgg aagaaaatat gttatccaaa atgatagtgg tcacaagaaa cggtaaaact       240
     gatttggata ttgaaggtgt atatgaagga tatgttgtaa gagaatatta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page