(data stored in ACNUC7421 zone)

EMBL: AL009126.YBCI

AL009126.YBCI        Location/Qualifiers
FT   CDS_pept        210572..210946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="BSU_01880"
FT                   /old_locus_tag="BSU01880"
FT                   /product="conserved hypothetical protein; prophage 1
FT                   region"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01880"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11964"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="SubtiList:BG12710"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34380"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11964.1"
FT                   /translation="MKKSKGSIESEISKSITQWEKDYLGRGSVSVKTDILRDMIIVNLK
FT                   GILTPAEYVVCGSKEGMLSIKQTRSELVESGIEGLKDIILKITGEKVKSFHTDLSSRTG
FT                   ERVMVFKLCNDLEKNLEKIL"
     atgaaaaagt ctaagggttc tattgaatca gagatcagta agtccattac tcaatgggag        60
     aaggattatc ttgggcgggg gtctgtatct gttaagactg atatactgcg ggacatgatc       120
     atcgtcaatt taaaagggat tttaacacca gccgaatatg tagtttgtgg atcaaaagag       180
     ggtatgttat ctatcaaaca aactcgttca gagttagtcg aatcaggtat agaaggcctt       240
     aaggatatta tcttaaaaat aaccggagaa aaagtgaaaa gttttcatac tgatttaagc       300
     tcccggacag gtgaacgagt gatggtattt aaattatgta atgatctaga gaaaaatttg       360
     gaaaagatct tataa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page