(data stored in SCRATCH zone)

EMBL: AL009126.YBCM

AL009126.YBCM        Location/Qualifiers
FT   CDS_pept        213155..213469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcM"
FT                   /locus_tag="BSU_01900"
FT                   /old_locus_tag="BSU01900"
FT                   /product="putative enzyme"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11983"
FT                   /db_xref="GOA:O31421"
FT                   /db_xref="SubtiList:BG12712"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31421"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11983.1"
FT                   /translation="MRFLKALPRRAEVQYDCLDRTLETQENVNLNIRVNVKEVATWGVN
FT                   TCIISLKGLDNADDRFVLPEVNTALALFPLSIAADCLLMLPCISVVMSISSVMKSVTVE
FT                   "
     atgagatttc ttaaggcttt gccgcggcga gctgaagtac agtacgattg ccttgatcga        60
     acactggaaa cacaagagaa cgtaaacctg aacatccgcg taaacgtcaa ggaagttgcc       120
     acttggggag taaacacttg catcatctcg ctgaaaggcc tagacaatgc ggatgacaga       180
     ttcgtattgc cggaagtaaa cacagcgctt gctctgtttc cgttgtcgat tgcagctgat       240
     tgcttactaa tgctgccctg catctcggtt gtgatgtcga taagcagcgt aatgaagagt       300
     gttactgtgg agtaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page