(data stored in ACNUC7421 zone)

EMBL: AL009126.YBDG

AL009126.YBDG        Location/Qualifiers
FT   CDS_pept        220279..221256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="BSU_01990"
FT                   /old_locus_tag="BSU01990"
FT                   /product="putative hydrolase/transferase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01990"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11993"
FT                   /db_xref="GOA:O31431"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12722"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31431"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11993.2"
FT                   /translation="MKTLWKVLKIVFVSLAALVLLVSVSVFIYHHFQLNKEAALLKGKG
FT                   TVVDVDGKKMNVYQEGSGKDTFVFMSGSGIAAPAYEMKGLYSKFSKENKIAVVDRAGYG
FT                   YSEVSHDDRDIDTVLEQTRKALMKSGNKPPYILMPHSISGIEAMYWAQKYPKEIKAIIA
FT                   MDIGLPQQYVTYKLSGVDRLKVRGFHLLTSIGFHRFIPSAVYNPEVIRQSFLTDEEKEI
FT                   YKAINFKQFFNADMEHELLQSYQNGSKSVNLPAPKETPVLILDAVSDQNRHSKYAIQNR
FT                   KDYEAFAAQFNTADIKELRGTHSIYLYQPDQIYKLSMEFMRKVR"
     atgaaaacat tatggaaagt cctcaaaatt gtttttgtca gcttggctgc tttggttttg        60
     cttgtatccg tctcggtatt tatttatcac catttccagc taaataagga ggcggcactg       120
     ctgaaaggta aaggcacagt agtcgatgtt gacggtaaaa agatgaatgt gtatcaagag       180
     ggaagcggga aggatacgtt tgtgtttatg tccggttcgg gtattgctgc gcctgcttat       240
     gaaatgaagg ggctgtacag caagttttca aaagaaaata agattgctgt tgtagatcgg       300
     gcaggttatg gatacagtga agtgtctcac gatgacagag atattgatac ggtattggaa       360
     cagacgagga aagcgcttat gaaaagcgga aataagcctc cttatatttt aatgcctcat       420
     tcgatatccg ggattgaagc gatgtattgg gcacagaaat atcctaagga aatcaaggcc       480
     attattgcga tggatattgg attgccccag cagtacgtca cgtataaatt gagcggagtt       540
     gaccgattga aagtgagagg gttccacctg ttaacctcga ttggttttca tcggtttata       600
     ccttccgctg tatataatcc tgaggtgatt cgacagtcgt ttttaactga tgaagaaaaa       660
     gaaatctata aagccattaa ctttaagcaa ttttttaatg cagatatgga gcatgagctt       720
     ttacagtctt accaaaacgg cagcaaatct gtgaatctgc ctgcgccaaa ggaaactccc       780
     gtcttgattt tagatgcagt ctctgaccaa aatagacatt caaagtatgc tatacaaaac       840
     cgaaaagact atgaagcgtt tgcggctcaa ttcaatactg ccgatataaa ggaactgagg       900
     ggaacacaca gtatttattt atatcagcct gatcaaatat ataaactgtc catggagttt       960
     atgagaaagg ttcgctag                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page