(data stored in SCRATCH zone)

EMBL: AL009126.YBDK

AL009126.YBDK        Location/Qualifiers
FT   CDS_pept        221950..222912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="BSU_02010"
FT                   /old_locus_tag="BSU02010"
FT                   /product="two-component system sensor histidine kinase
FT                   [YbdJ]"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 20035725; Product
FT                   type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02010"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11995"
FT                   /db_xref="GOA:O31433"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG12724"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31433"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 20035725"
FT                   /protein_id="CAB11995.1"
FT                   /translation="MLLFTAVISVPMLLLAVSVLMSVIYDSMFKPMNHGMPFHRSFAYP
FT                   AMIVVFLISLLLLAFLFSKSIHSLLHKINLLNQTIRHLASDQRVPDKIEVKRADEIGEL
FT                   IKSVNLLIERTTYRELELRQQEEIKKELLQKLRHDINTPLTALRLQLFYLEDQCHGQAV
FT                   FESLYQQIEYISELTNEFNLYSAETLESSYIVNEEVRLNELLETAVKKWDYLYSMSGIE
FT                   LHYKPADQDVIWMSNTLWMERLFDNIFQNTLRHSKAKKMEVTIEHGDVFIRDDGIGFDR
FT                   NESSEGLGLKIIEDTCRLLAITYELHTNDNGTGFLFSKE"
     ttgttattgt ttacggccgt cattagtgtt ccgatgctat tgctggcggt cagtgttttg        60
     atgtcggtga tttatgacag catgtttaaa ccgatgaatc atggtatgcc ctttcacagg       120
     tcgtttgcat acccggcaat gatcgttgta tttttgatat cactcttatt gttagctttt       180
     ttattttcaa agtcgattca ttctctgttg cataaaatca atctattaaa tcaaaccatt       240
     cggcatttgg cgagtgatca aagggtgccc gataaaattg aagtgaagcg tgctgatgaa       300
     atcggggaac tgatcaagtc ggtcaatttg ttaattgaac ggacgacata tcgtgaactg       360
     gagctgagac agcaggagga aatcaaaaag gagcttttgc aaaaactgcg gcatgacatt       420
     aatacacctt taacggctct caggctgcag ttattttatt tggaagacca atgtcatggt       480
     caggctgtat tcgaatcatt gtatcagcaa atcgaatata tctcggaatt aactaatgaa       540
     ttcaatctat attccgctga gacgctggaa agctcttata ttgtaaatga agaagtgcgt       600
     ctaaacgagc tattagaaac agcggtgaaa aagtgggatt atttatacag tatgagtggg       660
     attgagctgc actataagcc ggcagatcaa gatgtgatat ggatgagcaa cacgttatgg       720
     atggaaaggc tgtttgataa tatttttcaa aatacgttaa ggcattcaaa agctaaaaag       780
     atggaagtca cgattgaaca tggcgatgtt tttattcgtg atgacggtat tggatttgat       840
     cggaatgaga gcagtgaggg acttgggtta aagattattg aggatacatg caggctgctt       900
     gcgattactt atgagctgca tacaaatgat aacggaacgg ggttcttgtt ttcaaaagag       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page