(data stored in ACNUC7421 zone)

EMBL: AL009126.YBDM

AL009126.YBDM        Location/Qualifiers
FT   CDS_pept        complement(223219..223989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="BSU_02030"
FT                   /old_locus_tag="BSU02030"
FT                   /product="putative protein kinase"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.11.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 21304896; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11997"
FT                   /db_xref="GOA:O31435"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="SubtiList:BG12726"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31435"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11997.1"
FT                   /translation="MALKLLKKLLFDRPLKNGVILNHQYKIEECLGMGGYGLVYLCTDI
FT                   LAQTPYVLKQLRPTKAKKEKEKVRFQQEIKLLKNIHHPQIPGFIDEFIIDGQAYYVMQF
FT                   IEGENIEELLFFRKQPFTELMALQLISQLLEIIEYLHDRLIFHSDIRTPNIIINDGRLC
FT                   LIDFGLAKQLTPEEMEEIKVRKQDDFFDLGETLLFLLYSQYKGKKKKNGTWLEELTLTK
FT                   EVTLLLKRLLGIEEEYQHTASIREDLNRAIQSVT"
     atggcattaa aacttctaaa aaaactgcta tttgaccgcc ctctaaagaa cggcgttatc        60
     ttaaatcatc aatacaaaat cgaagagtgc ctcggtatgg gaggctacgg tttggtttat       120
     ttgtgcaccg atatcctagc tcaaacacct tatgtcttaa aacagcttcg gccgacaaaa       180
     gccaaaaagg aaaaagagaa agtccgattc cagcaggaaa taaaactgct caaaaacatt       240
     caccacccgc aaattccggg cttcatagat gaattcatca tagacggaca ggcttattat       300
     gtcatgcagt tcattgaggg agagaatata gaagaattat tattttttcg aaaacagccg       360
     ttcacagagc ttatggcgtt acaactgatt tcgcagctgc ttgagattat agaatacctg       420
     catgatcgcc ttatcttcca cagcgacatc agaacgccta atatcatcat caatgatggc       480
     aggctctgcc tcatcgattt cggccttgcc aaacaattga ctcctgaaga aatggaggaa       540
     ataaaggtac gaaaacagga tgacttcttc gatctcggag aaacgctgtt attcttgctg       600
     tactctcaat ataaaggaaa aaagaagaaa aacggcactt ggctggagga attaacactg       660
     acaaaggaag taaccttgct gctgaaaaga ttattgggca ttgaggaaga gtatcagcac       720
     accgcttcca ttcgcgagga tctaaaccgg gccattcaat cggtcacata a                771
//

If you have problems or comments...

PBIL Back to PBIL home page