(data stored in ACNUC7421 zone)

EMBL: AL009126.YBDN

AL009126.YBDN        Location/Qualifiers
FT   CDS_pept        complement(224075..224932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="BSU_02040"
FT                   /old_locus_tag="BSU02040"
FT                   /product="putative phage protein; prophage region 1"
FT                   /function="16.5: Explore"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 16794953; Product type
FT                   h: extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02040"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11998"
FT                   /db_xref="SubtiList:BG12727"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31436"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11998.1"
FT                   /translation="MVKKWLIQFAVMLSVLSTFTYSASAVGVTAITGNNSFDTAMPIGY
FT                   WKYKNIDTTILEAGQDEAYFTFTANKGEKVYMRSTYQSAYTGMKIEIYDKNRIPVSQGT
FT                   EVINPNTFSSFIYANADAQNTTDTFYVKVSRGTYTGNMYFTLSIEDRIKSGSGTFQFSG
FT                   VAENKGNTSLSPSGSDSSVIKVDLTNQSGIPRDAIVTRVQTTATQTPSQGNTRHLIMTS
FT                   ENNEWSRALVNSSTSGSYDISLSDQLSVAKVWSFKYNTLATARSTMSNVKAKIDYEYDV
FT                   TKQF"
     atggtgaaaa aatggcttat tcaattcgct gttatgcttt ctgtcttatc tacctttacg        60
     tattcggcat cagctgtcgg agtcactgct atcacaggaa acaattcatt tgataccgca       120
     atgccgatcg gttattggaa atataaaaat atcgatacaa caatactgga agctggtcaa       180
     gatgaagcct atttcacttt tacggctaat aagggagaaa aagtatacat gaggagtaca       240
     taccagagcg cgtatacagg gatgaaaatt gaaatttatg acaagaacag aatacctgtt       300
     tctcaaggga cagaagttat taaccctaat acgttttctt cttttattta tgcaaatgca       360
     gacgcccaaa acacgacgga taccttctat gtgaaagtgt cacgaggcac ctatactgga       420
     aacatgtact ttacgctttc aattgaagac cgaatcaaat caggcagcgg aacgttccaa       480
     ttcagcggcg ttgctgaaaa taaaggaaat acaagcctta gcccctcagg ttctgactcc       540
     agcgtgatca aggttgattt aacaaaccaa tctgggatac cgcgtgatgc cattgtaacc       600
     agagttcaaa caaccgccac tcaaacacca agccagggaa atacacgcca tctgatcatg       660
     acaagcgaaa ataacgaatg gagccgtgcc cttgtaaaca gctcgacttc agggtcttat       720
     gatatctctt tgtcggatca actcagtgtg gcaaaggtat ggagttttaa atataataca       780
     ttagcgacag ccagatcgac gatgagcaac gtaaaagcaa aaatagatta tgaatacgac       840
     gtgacaaagc agttttaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page