(data stored in ACNUC7421 zone)

EMBL: AL009126.YBDO

AL009126.YBDO        Location/Qualifiers
FT   CDS_pept        225064..226248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /locus_tag="BSU_02050"
FT                   /old_locus_tag="BSU02050"
FT                   /product="putative phage protein; prophage region 1"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15033535; Product type
FT                   h: extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11999"
FT                   /db_xref="InterPro:IPR032617"
FT                   /db_xref="SubtiList:BG12728"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31437"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11999.1"
FT                   /translation="MRLNRQFIRTQLIAQNILSKNAPAKRENATENPAAVLEKAYSRLK
FT                   SQSSTGGINQFNYSKTSVSGNSGTFSKVYQSANDRTVTDTGEETVIQSQNPYESESDIR
FT                   IKILDEKYSRMNAINKTKSDPLGYIKDKYQNSKSPYFRSDLSAAERQAAYDNETEWLFK
FT                   GKAQNYNLQDAVFRNVTFHGEVEAENEKVYQRGQVNQQLQVLLNRNHIHIPEGTELTFT
FT                   ITPIDYQVRVSGTDDQDLIKQIEQVLQSGDNSKELFLHIMKSQSSDSAQFSEEAYKKYQ
FT                   AAREMYEVTGYHLKDLEVIDGRYVTPEGRDLMDVYKEELEKDPVQKQTASYAISYYRSE
FT                   LSKIAEAGYNAIPDFILSIDYSNGSLRDVGQSKSYGTGDTGWLEALKRQTGVNY"
     atgcgtctga atcggcaatt tatccgcact cagctgattg cacagaacat attgagcaag        60
     aatgcgcctg ccaaacggga gaatgcgact gaaaatccag cggcagttct ggaaaaggca       120
     tatagcaggc ttaagtcaca atcttcaact gggggaatca atcagttcaa ttattctaaa       180
     accagcgtgt cgggaaacag cgggacgttc agcaaagtgt atcaatcagc gaatgatcga       240
     acagtgacag acacagggga agaaacagtg attcaatccc aaaaccccta tgaatctgag       300
     agtgatatca gaatcaaaat actagatgaa aaatacagca ggatgaatgc gattaataaa       360
     acaaagtctg atccattagg ctatattaag gataagtacc aaaattcaaa gtctccttat       420
     ttcagaagtg atctgtcagc tgcagaaaga caggccgctt acgataatga aacagaatgg       480
     ttattcaaag ggaaggcgca aaactataac cttcaggatg ctgtgtttcg gaatgtcaca       540
     tttcatgggg aagtggaagc tgagaatgaa aaggtgtatc agcggggaca ggttaaccag       600
     cagctgcaag tactgttgaa tcgaaaccat attcatattc cagaggggac agagctgacg       660
     tttacaatca caccgattga ctatcaggtg cgggtaagcg ggacagacga tcaggatctg       720
     atcaagcaaa ttgagcaagt gctgcaatct ggagacaaca gcaaagaact atttttacac       780
     atcatgaaaa gtcaaagcag tgattcagca caattttccg aagaggccta taaaaagtat       840
     caggcagctc gtgagatgta tgaagttaca ggctaccatt tgaaggattt agaagtgatt       900
     gatgggcggt acgtcacgcc tgagggacgt gacttaatgg atgtatataa ggaagagctt       960
     gaaaaagatc cagtgcagaa acaaacggct tcttatgcta tatcttacta tcgttcagag      1020
     ctcagtaaaa tcgcggaagc cgggtataat gccattccgg atttcatcct atcaattgat      1080
     tacagcaatg gatctctgag agatgtggga caaagcaaga gctatgggac cggagatacc      1140
     gggtggcttg aagcattaaa gcgtcaaacg ggtgtgaatt attag                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page