(data stored in SCRATCH zone)

EMBL: AL009126.YBEC

AL009126.YBEC        Location/Qualifiers
FT   CDS_pept        231348..232967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeC"
FT                   /locus_tag="BSU_02120"
FT                   /old_locus_tag="BSU02120"
FT                   /product="putative H+/amino acid transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12006"
FT                   /db_xref="GOA:Q45577"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="SubtiList:BG12730"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45577"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12006.2"
FT                   /translation="MNQLHRRMGTFSLMMVGLGSMIGSGWLFGAWRAAQIAGPAAIISW
FT                   VIGMVVILFIALSYSELGSMFPEAGGMVKYTQYSHGSFIGFIAGWANWIAIVSVIPVEA
FT                   VASVQYMSSWPWEWAKWTSGLVKNGTLTGEGLAFASVLLLIYFLLNYWTVNLFSKANSL
FT                   ITIFKIIIPGLTIGALLFVGFHGENFTGGQSIAPNGWASVLTAVATSGIVFAFNGFQSP
FT                   INMAGEAKNPGKSIPIAVVGSLFVATVIYVLLQIAFIGAVNPSDIAHGWSHLNFNSPFA
FT                   DLAIALNINWLVIVLYADAFVSPSGTGITYTATTSRMIYGMEKNKYMPSIFGKLHPIYG
FT                   VPRQAMFFNLIVSFIFLFLFRGWGVLAEIISVATLISYITGPITVMTLRRTGKDLYRPL
FT                   RLKGLNVIAPLGFIFASLVLYWARWPLTGQVLFIILIGLPIYFYYQAKAKWKGFGRNFK
FT                   AGVWMVFYLLAMMVISYLGSDKFGGLNVIHYGWDMVLIAMVSLVFYVWALKSGYQTEYL
FT                   KDAKEINSQLLNGQSEAAAGKE"
     atgaatcaat tgcatcgaag aatgggaacg ttttccctca tgatggtcgg gctcgggtcg        60
     atgatcggtt caggctggct gttcggggct tggcgtgcgg ctcaaatagc aggaccagct       120
     gctattattt catgggttat tggaatggtc gtcattttat ttattgctct ttcttatagt       180
     gaactaggtt ctatgttccc tgaagcgggg ggaatggtca aatacacgca atattcacac       240
     ggttcgttta tcggttttat tgcgggctgg gccaactgga ttgcgattgt gtccgtcatt       300
     ccggttgaag cggtggcctc cgttcaatat atgagttctt ggccttggga atgggcgaaa       360
     tggacaagcg gtttggtgaa gaatggaacg ctgactgggg aaggactagc gtttgcctct       420
     gtattgcttc tcatttattt tctgctgaac tactggacag tcaatctatt ttcgaaagcg       480
     aattcattaa ttacgatttt taaaattatt attccgggtc ttacgattgg agctttgctg       540
     tttgtcggat tccacggaga aaactttact ggcggtcaaa gcattgcgcc gaatggctgg       600
     gcaagtgtgc tgacggcggt tgccacttcc ggtatcgttt ttgcgtttaa tggtttccaa       660
     agcccgatta atatggcggg tgaagcaaaa aatccgggga aatcaatccc gattgcggtt       720
     gttggctctc tttttgttgc gacagtgatt tatgtcctgc tgcagatcgc cttcattgga       780
     gctgtgaatc cttctgatat tgctcacggc tggagccatc tgaattttaa ttctcctttt       840
     gctgatctgg cgattgcgct gaatattaac tggcttgtta ttgtgttata tgcagatgca       900
     tttgtatcac cgtctggaac ggggattacg tatacggcga caacgtcccg aatgatttac       960
     ggaatggaaa aaaacaaata catgccgagt atattcggga agcttcatcc gatttacggc      1020
     gttccgcgac aagcaatgtt ctttaacttg attgtttcgt tcatcttttt gttcctgttc      1080
     agaggatggg gcgtattagc ggaaattatt tctgttgcta cgttaatttc ttatatcacc      1140
     ggcccgatca cagtgatgac attgagacgg acggggaaag acctgtacag gcctcttcgt      1200
     ttaaaaggct taaatgtgat tgctccgctt ggatttatct ttgcgtcact ggtgctgtat      1260
     tgggcgcgct ggccgttaac aggacaggtt ctgtttatta tcctgatcgg tcttccgatt      1320
     tatttctatt atcaggcgaa ggcgaaatgg aaagggtttg gccggaactt taaagccggc      1380
     gtctggatgg tgttttatct gctggccatg atggttattt cttatttggg cagtgataaa      1440
     ttcggcggcc tgaatgtcat tcattatggc tgggatatgg ttctgattgc gatggtatcc      1500
     cttgtattct atgtgtgggc gctgaagagc ggctaccaga cagaatactt aaaggatgcg      1560
     aaagagataa attctcagct gcttaatgga cagtcagaag ctgctgccgg aaaagaataa      1620
//

If you have problems or comments...

PBIL Back to PBIL home page