(data stored in ACNUC7421 zone)

EMBL: AL009126.YBFA

AL009126.YBFA        Location/Qualifiers
FT   CDS_pept        235965..236882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="BSU_02160"
FT                   /old_locus_tag="BSU02160"
FT                   /product="putative transcriptional regulator with
FT                   acetyltransferase domain"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02160"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12010"
FT                   /db_xref="GOA:O31443"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG12732"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31443"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12010.1"
FT                   /translation="MKTRESSVGLKFRKFNRFYTNVLGFLNEHIYDSPFSLTETRILFE
FT                   IYNTPNCTAKALQDKLGLDRGYVSRIVKQFEKEDLIYKQRSKDDARHHYIFVTETGKTI
FT                   YKKLEEKANEQVELMLKVINQKEQHKLAEAMAEIEAILSQSLSARASEISIRDYFLSED
FT                   LQLLIEKQRQFYAEAHGWDDTFLAYLQETFDADIEKIWIAESGGKFAGSVGLVKHDEKT
FT                   VQLRWFLVDADFRGRGLGTQLLEHLVAYCQDMKFDRIFLWTVSTMAEARPLYKKFGFRI
FT                   SEVKQEAPLWGQQLTEERWDLELS"
     ttgaaaacaa gagaatcatc tgtcgggtta aaattcagaa agttcaatcg attttataca        60
     aacgtccttg gtttccttaa tgagcacatt tacgacagcc cgttttcctt aacagaaaca       120
     cggattttat ttgagattta taatacgcct aattgtacgg caaaagctct tcaggataag       180
     ctggggcttg accggggata tgtcagcagg attgtgaagc agtttgaaaa agaagatttg       240
     atttataaac agaggagcaa agatgacgcc cgccaccatt acatttttgt cacagaaaca       300
     ggaaaaacga tttataaaaa gctggaggag aaagccaacg aacaagtaga actgatgctg       360
     aaggtaatca accaaaagga gcagcacaag cttgccgagg cgatggcaga gattgaagcg       420
     atcctttcac agtcgctttc tgccagagca tcagagatat cgattagaga ttattttctt       480
     tcggaggatc ttcaactcct tattgagaaa caaagacaat tttacgcgga ggctcacggt       540
     tgggatgaca cgtttttagc ttatcttcag gagacatttg acgctgacat cgaaaaaata       600
     tggattgcgg aaagcggcgg gaaatttgcc ggctctgtcg ggttggtcaa gcacgatgaa       660
     aagacagtcc agctcagatg gtttctggtt gatgcggatt ttcggggcag ggggcttggc       720
     acgcaattgc tggagcatct ggttgcatac tgccaagaca tgaagtttga ccgcattttc       780
     ctttggacgg tgagcacgat ggctgaggct cgtccgctct ataaaaaatt tggattcagg       840
     ataagtgaag taaaacaaga agcgccatta tggggacagc agctgacaga agaacggtgg       900
     gatttggagc tgtcatga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page