(data stored in SCRATCH zone)

EMBL: AL009126.YBFF

AL009126.YBFF        Location/Qualifiers
FT   CDS_pept        complement(238644..239555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfF"
FT                   /locus_tag="BSU_02190"
FT                   /old_locus_tag="BSU02190"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12013"
FT                   /db_xref="GOA:O31446"
FT                   /db_xref="SubtiList:BG12735"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31446"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12013.1"
FT                   /translation="MKNDQIVFEKTKNIAHDINQMQNQQEIIDYLFRQDSLTLNQLKHY
FT                   YSEPSLPLQFLVKVAVLCMFISMTLASFLFIQAKEVFTNTILSDISPAVFSIFTVICIF
FT                   MTYTKIIKKGNKNKGKASLNQRSEFYEKNKLINTILYKKYKMDQQNIQANKHTASDNED
FT                   SMNFSAVLNHVLTISKNDKELLGYLDTRDNAMLSQLKAYFSTRPFSLPHYMSLMFCGSI
FT                   IVVYATSLFSGQINYIDIPHIFIFLLLIIFLKILIDLIKLLNISRKGQLHTVLHFAQRA
FT                   EYLRMRGVIDFILTERYNKKIM"
     atgaaaaatg atcaaatagt ttttgaaaaa acaaaaaaca tcgctcatga tatcaatcag        60
     atgcaaaatc agcaggagat aatagattat ctttttcgcc aagattctct gacactcaac       120
     cagttgaagc actattattc ggaaccttct cttccgcttc agtttcttgt gaaagtagca       180
     gttttatgca tgtttatatc tatgacttta gcttctttcc ttttcatcca agcaaaagaa       240
     gtcttcacca atactattct ttcagatatt tcacctgcag tgttttctat ttttacagtc       300
     atttgtattt ttatgactta tactaaaatc ataaaaaaag gaaataaaaa caaaggaaaa       360
     gcatccctta atcaacgatc tgaattctat gagaaaaaca agttaattaa tacaatactt       420
     tataaaaaat ataaaatgga tcaacaaaac atacaggcta ataaacatac tgcctctgat       480
     aatgaagatt caatgaattt tagtgctgta ttgaatcatg ttcttacaat tagtaaaaat       540
     gataaagagc ttttgggcta cttagataca agagataatg ctatgctaag ccaattaaaa       600
     gcatattttt caactcgtcc attttccctt ccacattata tgagtttgat gttttgcgga       660
     agtattattg ttgtctatgc aacttcttta ttttcaggac aaatcaatta cattgacata       720
     ccacacattt ttatctttct attattaatt attttcttga aaatccttat tgatttgata       780
     aagcttttaa atatatctag aaaaggacaa ttacatactg ttctgcactt tgcacagaga       840
     gccgaatatt tgcgaatgag aggagttata gattttattc taactgaaag atataacaaa       900
     aaaatcatgt aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page