(data stored in ACNUC7421 zone)

EMBL: AL009126.YBFG

AL009126.YBFG        Location/Qualifiers
FT   CDS_pept        complement(239644..241842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfG"
FT                   /locus_tag="BSU_02200"
FT                   /old_locus_tag="BSU02200"
FT                   /product="putative pepdidoglycan binding protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12014"
FT                   /db_xref="GOA:O31447"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="SubtiList:BG12736"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31447"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12014.1"
FT                   /translation="MVDEMVLITQQWLNDTYSGKHGYNPVEESGKTGWDTIYGLTRALQ
FT                   IELGISEPADNFGPTTQRLFKPLKRQAPDSKPSNMNFILQGALWCKGFNPGGFTGVFYE
FT                   KTENAVKEFQKAAGLTTQDGIVTTLIMKALLDMSAFKLVSGGDSRIRQIQQNLNRDYND
FT                   YIGLMPCDGLYGRDTNKALIYALQKEEGMSTSVANGFFGNGTTSLCPTLTPGDSRTGFV
FT                   LIVQYALYCNGKSFDPGEFDGKYGVGVVSAVKAFQEFMCLPQTGYADMPTIKALLSSSG
FT                   DTTRTASACDTATIITAEKAQTLRNNGYKTVGRYLTGNVRTSSGLTSKALTSKELAVIL
FT                   DAGLKVFPIYQDGGYESSYFVKDQGTRDAYSAASAARRLGFPSGTTIYFAVDFDAYDYE
FT                   VTDKIIPYFQEIKSAFTKMQTFSTAPKYEIGVYGPRNICIRTSEAGLTKYSFVANMSTG
FT                   FSGNLGYPMPNNWAFDQFYEGTIGSGSGSIGIDKDGYSGRDSGASNVNPPSDPVYDARL
FT                   RTLTDILSTIPALENLTSLANAMFEFDTTETIFTSPELDIILSTSLLATIPSEGSPNTI
FT                   TITNGKPGAYITGLLGDTQTSLTASQIDSYQNLLNSLSLSVRNGYLEVYVNPTAESLNI
FT                   QIKIYTPDIPVGDNVTTGLTTTITFKIKTYKGVPVTSPESELALDWPSYDQYLFPVVGV
FT                   AALLLIGNMGSDLTNNKGVKVATALSAMLLAIFAYYTS"
     atggttgatg aaatggtctt aatcacacag caatggctga acgatacgta cagcggcaaa        60
     catgggtata acccagttga agaaagcggg aaaactgggt gggatacgat ctacggtctg       120
     actcgggcgc ttcaaattga attgggtatc tcagagccag ccgataactt cgggccgaca       180
     acacagcgct tatttaagcc tcttaaacgc caagctccag attcaaaacc aagcaacatg       240
     aattttattt tacaaggggc tttatggtgt aaaggcttta atcccggcgg ttttacaggc       300
     gtcttttacg aaaaaacaga aaatgcggta aaagaatttc aaaaagctgc cggactgaca       360
     acacaggatg ggattgtcac cacgttaatt atgaaagcct tattagacat gagcgctttt       420
     aagctggtgt ctgggggtga ttcaagaatt cgccagattc aacaaaactt aaatcgagac       480
     tacaatgact atatcgggtt aatgccttgt gacggactgt atggccgcga tacaaataaa       540
     gctcttattt atgccctgca aaaagaagaa ggcatgagca caagtgttgc caatggattt       600
     ttcggaaacg gcaccacaag tttgtgccct actttaactc ccggcgattc aagaacagga       660
     tttgtcttaa ttgttcagta cgccctctat tgtaacggaa aatcgttcga tcctggtgag       720
     tttgacggca aatatggtgt gggtgttgtt tcagctgtta aagcatttca agagttcatg       780
     tgcctgccgc aaacaggtta tgcagatatg ccaaccatta aagctttatt atcaagctca       840
     ggagacacaa ctcgcaccgc ttctgcttgt gacactgcta caattataac cgcagaaaaa       900
     gctcaaacac tgcggaataa cggttataaa acggttggca gatatttgac cggaaatgtg       960
     cggacaagca gcggcctcac atctaaagcc ctgacatcta aagagcttgc agttattctt      1020
     gatgccggat tgaaggtttt cccaatttat caagacggcg gctatgaatc ttcttatttt      1080
     gtcaaagacc aaggcacaag agatgcatat agtgccgctt ctgctgctag aagattaggt      1140
     tttccgtcag gcacgaccat ttatttcgct gtcgattttg atgcatacga ttatgaagtg      1200
     accgataaaa tcattcctta tttccaagag attaagtcag catttacaaa aatgcagaca      1260
     ttttcaaccg cacctaagta tgaaataggg gtttacggac caagaaacat ttgtatccgt      1320
     acatctgaag caggactgac aaagtatagt tttgtggcaa atatgtcaac aggatttagc      1380
     ggcaatctcg gctatccgat gccaaacaac tgggcctttg atcaatttta tgaaggaacc      1440
     atcggaagcg gctctggaag catcgggatt gataaagacg ggtattcagg aagagactca      1500
     ggtgcaagca atgtaaatcc gccgtctgat ccggtatatg atgcaagact gcgtacactg      1560
     acagacattt tatctaccat tccagcttta gaaaatctaa caagtctggc aaacgcgatg      1620
     tttgaatttg atacgacaga aaccattttc acatcacctg agttggatat tattctatca      1680
     acttcacttc tggcaaccat accaagtgaa ggttcaccaa acacaattac cattacaaat      1740
     ggtaaaccag gtgcctatat cacgggttta ttgggcgaca ctcaaacgtc tctcactgcg      1800
     tcacaaatcg actcttatca aaacctttta aatagtctga gcttatcagt acgcaacggt      1860
     tatttggagg tttatgtaaa tccaacagct gaatctttaa acattcaaat taaaatctat      1920
     acacctgata ttccagtcgg tgacaatgtc acaactggac taacgactac gattacgttt      1980
     aaaataaaga cgtacaaggg agtaccagtt acgtctcccg agagtgaatt agcgttagat      2040
     tggccgtctt atgatcaata tttattccct gttgtaggtg ttgctgcact tttactaatt      2100
     gggaatatgg gcagtgattt aacgaacaat aaaggagtca aagtcgctac cgcattatct      2160
     gctatgttac tggccatttt tgcttattat actagctaa                             2199
//

If you have problems or comments...

PBIL Back to PBIL home page