(data stored in ACNUC7421 zone)

EMBL: AL009126.YBFM

AL009126.YBFM        Location/Qualifiers
FT   CDS_pept        248268..248756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfM"
FT                   /locus_tag="BSU_02280"
FT                   /old_locus_tag="BSU02280"
FT                   /product="putative membrane phosphatase"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12682299, 14762009,
FT                   15849754, 16850406; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12022"
FT                   /db_xref="GOA:O31453"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="SubtiList:BG12741"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31453"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12022.1"
FT                   /translation="MELVQQLIADYGYLAIFLMLVLGIVGLPIPDEVMMTVVGYFTHTD
FT                   VLNYELSILISFVGALLGMLISYMIGRKAGRPFIDKYGKWVGLKEKRMMKVEKWMKKYG
FT                   PYSLILGYFIPGVRHVTCYFSGIGKMDLKTYVAFAAIGAFLWCFVFITIGRVIGIIHV"
     atggaattag ttcagcagct catagcggat tacggttatc tcgctatttt tttgatgctg        60
     gtattaggaa ttgtaggatt gccgattcca gatgaagtga tgatgaccgt tgttggctat       120
     ttcacgcata ccgatgtatt gaattatgag ctttcgatat tgattagttt tgtcggggct       180
     ttgttaggta tgctgatcag ctacatgatt ggcagaaaag ccggacgccc gtttatcgac       240
     aagtacggca agtgggtcgg cttaaaagaa aaaagaatga tgaaagtgga aaaatggatg       300
     aagaaatacg gtccatattc tcttatttta ggttatttta ttcccggcgt cagacatgtg       360
     acgtgctact tttcggggat cggcaaaatg gatctgaaaa cgtatgttgc gtttgctgca       420
     atcggcgcct ttttatggtg ctttgttttt attacaatcg gaagggttat agggattatt       480
     catgtttaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page