(data stored in SCRATCH zone)

EMBL: AL009126.YBFN

AL009126.YBFN        Location/Qualifiers
FT   CDS_pept        249595..249873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfN"
FT                   /locus_tag="BSU_02300"
FT                   /old_locus_tag="BSU02300"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12024"
FT                   /db_xref="SubtiList:BG12742"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31454"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12024.1"
FT                   /translation="MEKQIISWITDYQNTGDEAVLRQVREVCWPIVEAVLQEKVMDDEQ
FT                   ANNLREKGIERFPFIISKYQADVQLPVETFLQNTYRFYFHQVMRESS"
     atggagaaac aaatcatcag ctggattaca gattatcaga acaccggaga tgaagccgtc        60
     ctgcggcaag tgcgagaagt gtgctggccg atcgttgaag cggttttgca agagaaagta       120
     atggatgatg aacaagcgaa caatttgcgc gaaaaaggaa tcgagcggtt tccattcatc       180
     atcagcaaat accaagcgga tgtgcagctt ccggttgaga catttttaca aaatacgtat       240
     cggttttact ttcatcaggt gatgagagaa tccagctaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page