(data stored in SCRATCH zone)

EMBL: AL009126.YBFO

AL009126.YBFO        Location/Qualifiers
FT   CDS_pept        249979..251319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfO"
FT                   /locus_tag="BSU_02310"
FT                   /old_locus_tag="BSU02310"
FT                   /product="putative exported hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02310"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12025"
FT                   /db_xref="GOA:O31455"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="SubtiList:BG12743"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31455"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12025.1"
FT                   /translation="MKRMIVRMTLPLLIVCLAFSSFSASARAASEEKYWDHWIERHAQP
FT                   LDASNASNKDLRFLKKVLKGKRIVQLGETTHGAGEINATKVRMIKYLHEELGYDVLAFE
FT                   SGFPDTNASYLNMDQLTPKSTMKNSIYAVWHTEDVVELFDYMKEQKEKGDPLILTGFDI
FT                   QSMKNSFNVAATQWVKAVDPEKAELLSQSENDFSTLVTDSNTFDEFSQKKEKLVKNYQK
FT                   LIKFTKTHASELKENLPKEPKAYEMFMHSLQLRIDVMETYMLEEMKEKLEEYPENIEDF
FT                   SFFMRDRMMAEQFQWVADTLYPKKKIIVWGHNYHLRKQNTKMIKDWVQLNGPNMGDYLP
FT                   ERLKKQTYTIGIYAYSGASLDSSDNKTVKPVTSPPPSGSLEALLKAADRPAVFVDFLHT
FT                   KNKKGTSWMYTPRTALYWGYMEEQMILKEQYDGVIWLEHITPSVIIK"
     ttgaaacgaa tgatagtgag aatgaccctg ccgctgctga tcgtttgtct ggcgttttct        60
     tctttttcag cctcagcccg tgctgcttct gaagaaaaat attgggatca ctggattgaa       120
     cgacatgcac agcctctgga tgcttccaat gcttcaaaca aagaccttcg atttctaaaa       180
     aaggtgctga agggaaaacg aatcgttcag ttaggagaaa ccacacacgg tgctggcgaa       240
     atcaatgcca caaaggtcag aatgatcaaa tacctccacg aagagctggg atacgatgta       300
     ttggcctttg aatccggctt tcctgataca aatgcatcct accttaatat ggaccaatta       360
     acccctaaaa gcacgatgaa aaactccatt tacgctgtat ggcacacaga agatgtcgtc       420
     gaattgtttg attacatgaa agagcaaaaa gagaaaggcg atccgctgat ccttaccggt       480
     tttgatattc aaagcatgaa gaattcattc aatgtagctg cgactcaatg ggtaaaagcg       540
     gtggaccctg agaaagcaga gttgctctcc caatcagaaa atgatttttc aacattagtg       600
     acagacagca atacgtttga tgaattttcg caaaagaagg aaaagcttgt gaaaaactat       660
     cagaagctga tcaagttcac taaaacacat gcttcagagc taaaagaaaa ccttccaaaa       720
     gagccgaaag cttatgagat gtttatgcat tctcttcagc tgagaattga cgtaatggaa       780
     acatatatgc tggaagaaat gaaagaaaaa ctagaggagt atccggagaa tattgaggat       840
     ttttcattct ttatgagaga ccgcatgatg gctgaacaat ttcagtgggt agccgacacc       900
     ctttatccga aaaagaaaat cattgtctgg ggccacaatt accatctacg caaacagaat       960
     acgaagatga taaaggactg ggtacagcta aacggcccta acatgggtga ttatttgccg      1020
     gagcggctga aaaaacaaac atatacgatt ggcatttatg cttactcagg tgcgagtctt      1080
     gatagctccg ataataagac tgttaagccg gttacaagcc cgccgccgtc tgggagcctt      1140
     gaagctttgc tgaaagcggc ggaccgaccg gctgtttttg ttgattttct ccatacaaaa      1200
     aacaagaaag gcacttcgtg gatgtatacc ccgcggactg cgctctattg ggggtacatg      1260
     gaagagcaga tgatcctgaa ggaacaatat gacggtgtca tttggctgga gcatatcacg      1320
     ccctctgtca ttatcaagtg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page